SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE16715 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE16715
Domain Number 1 Region: 324-414
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.00076
Further Details:      
 
Domain Number 2 Region: 153-229
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000336
Family Eukaryotic type KH-domain (KH-domain type I) 0.00071
Further Details:      
 
Domain Number 3 Region: 53-130
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.00087
Further Details:      
 
Domain Number 4 Region: 243-314
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000394
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE16715   Protein: RP28718   Gene: WBGene00070128
Sequence length 751
Comment RP28718 WBGene00070128 status:Partially_confirmed
Sequence
MSYMDQRVSSSTQPSSKRDYYERSDGFDEYEPTDPVPSKRSRSSPSRSYDPQGMDHRSTV
IRSEYPIPEQCVGLVIGRNGSEIHSISQRSGCRVQVTTEPTNTGYRIVEIYGVPDKISRA
RDLINEVISRAPHQPPPSPFPPSNALQHPTSDLPKVTIEIPIPADKCGSIIGKGGETMRR
LRSSSNCHIQLIQENNIGGIVKPLRITGDRQEVEHAQQLVAKILAEHDEPPSPALMAGNG
IATMSLQVKVPRSTVGAIMGVQGATIKKLSDETGTKIQFLPDDDTKLMERSLAIIGNRSK
VYVAAQLIKQIVDSSNDCANQAVALFYMSIPASKCGLVIGRGGEVIKQINAESGAHVELS
REANKDPLEKTFVIRGSDIQVEHAKHLICIKVGDIPPNTPFVRPGAHPQQMHHPHMQQPH
PMQQMQGHPHVQQHHQMQSQHPMQSQNTMTNVQMWTGQPIIQQQPHSPLVTQLHQHQLQQ
QQLQQQQLQQQQLQHHQMHQQQQQMQLQQQRIQQQQQLQQHQQLQQAQPAHVMPQHIQQR
MIPQQGQPVYGQPSYPSQPNVAGPPGYQQPNAASWQTARPQVNPTSPGGISVTQQMFPQV
HQMHMQQQQQGRQQQLQQQHQPVQQVQQAIQSQQPQPQAKKQSRAATRTASPEGPSLYAQ
MARKAEEEDRAKKEEARRAEAAKKAAAQKEETKTDGEEPDFSEQWLQYYININDHTNAEN
VRRRIAEMKAEKAQKAAAAARASSSEHGFQK
Download sequence
Identical sequences E3MAM3
CRE16715 XP_003106764.1.11157 31234.CRE16715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]