SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE16890 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE16890
Domain Number 1 Region: 174-295
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-28
Family Eukaryotic type KH-domain (KH-domain type I) 0.00026
Further Details:      
 
Domain Number 2 Region: 80-172
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.26e-21
Family Cold shock DNA-binding domain-like 0.00011
Further Details:      
 
Domain Number 3 Region: 30-82
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000000785
Family ECR1 N-terminal domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE16890   Protein: RP09466   Gene: WBGene00066119
Sequence length 303
Comment RP09466 WBGene00066119 locus:Cre-exos-2 status:Predicted
Sequence
MSIEISGPPLVSPWMMLTMSDARNDIDKDKIVIPGQAVCDAPQQFMRGHGTYIRDGEIVS
SLSGVVQQLNRLLMVKTIKQRYAGEVGDVVVARVVEVQAKRWKCDVSSRLHANLPLGSVL
LPGGDFRRKDVEDEEKMSEFLKNGELICAEVQQVQHDGTLMLHTRNNKYGKLQQGILIKV
PPHLIKKSKKHFHTLPYGMAVIIGCNGNVWVTPALPETTVEEDGSHVHEFQIVPQDIRLV
MIRVAACVRLLRDYSISIFLNSLTTCYEMSQPYDIKELSEQETSSRLAYLITARLLQELQ
QQK
Download sequence
Identical sequences E3MS76
31234.CRE16890 CRE16890 XP_003101007.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]