SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE16993 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CRE16993
Domain Number - Region: 109-158
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.021
Family Eukaryotic type KH-domain (KH-domain type I) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE16993   Protein: RP47456   Gene: WBGene00079460
Sequence length 197
Comment RP47456 WBGene00079460 status:Predicted
Sequence
MEPNEHCICISVKFHVNDIRNQLGLVKMSVGGTVYAHRYRYVYIEGEADLIARARLELDE
MCLQRLEHKYNEEKGNAEHLVNYIHHIPEEVAEKMRFQRVFNEAMRRVKRCGVQIDHQRN
PHTDKDNPPVEIRGRANRIREGKRCLDNCIEELASRNPRVRKWRFLGTSFPELSEKEELT
STGFERYPVPKSSSRME
Download sequence
Identical sequences E3N7V5
31234.CRE16993 XP_003095494.1.11157 CRE16993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]