SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE17709 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CRE17709
Domain Number - Region: 10-65
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0366
Family GntR ligand-binding domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE17709   Protein: RP27516   Gene: WBGene00080774
Sequence length 85
Comment RP27516 WBGene00080774 status:Predicted
Sequence
MGKEKLAFAKELTETLRMFREQMVASAEIQQQQMAENRRLHEEIAARAAAGSETETLENM
EKTYRQESKSGYYWMRSMNQRSIVM
Download sequence
Identical sequences E3NU06
CRE17709 31234.CRE17709 XP_003088115.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]