SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE20357 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE20357
Domain Number 1 Region: 563-608,661-692
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000246
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 
Domain Number 2 Region: 316-392
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000614
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 3 Region: 403-494
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000744
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 4 Region: 714-793
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000292
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE20357   Protein: RP20984   Gene: WBGene00061760
Sequence length 856
Comment RP20984 WBGene00061760 status:Partially_confirmed
Sequence
MDYFNAGGGGSTGNGNTDPYAVIPQQFGNGGQQPQQQTVYSDYQHEGVAEYDAYQQQQQQ
QPQYRAAQTSQQSPSVYFQNQMNAAPGSYFPIHSASEHDFLGPQQPPTGAAASSGSTAAP
YQARSGSNKEFMIQHQQRRGNQSGQQQNQQSQQNSQQQQNQTGRQQNQQQMQQQTNQSSH
YMHQQLQAAAQQQQAQQMHQRLHGVPINPQQFMVPPPSMMQPQQMHQQQQVHQMQQMQLQ
QQQQMVQHQSQQVNNILVQSEQIKTFKGYHPHQQNQPHAGGHQHHNQNQNQHNLNHPGQH
SIPQNAMLPRVVIRDWPIRCVVEGKYQSVIIGLHGSTIREIAQFTRCRVEFINLSKKERS
VLGHNERILTIHGHADQASKAISRVLEVIQSEALKDDVNVGADIVLRLRAHNQLCGRLIG
KAGSSIKEIMQKTGTNITVTKFIEPPGGLSSVRPEEMLLILERTIMVRGPSIEAVVQAES
LISAKLKKCYESDAQNRASPVMPIMMPQMPQQGVSPSSAVQGPHIIPTPVGLVQVQHFPR
SQHHLQGNANNSFLQPGVIQIAPGISNLRQVRMWVPDSMIGALIGAKGKNIKMIIRETGA
AVKIEGPEEKAQREAEEEEESKKRSVETESDERDGAASGDQPQEFLEDNGTVTSSDAIEG
KPKPVSERMVTISGDDFQLLKAQSYVFSKIAETSAALPATSDNMERGHLLKIRTEVSVPT
RIIGRIIGKGGQNVRELQRITGAVVKIPEEERNGGEVHKHEDGIEEEVTMIRTFGNMYST
HNVQFRLAHLVGEYYRSGEHRQRQSDRKTARPQSAAQEKEGTGLDKMDLLGKVPPLSNNS
NRASPKSGSSTKSKSP
Download sequence
Identical sequences E3MCX9
CRE20357 31234.CRE20357 XP_003106036.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]