SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE20425 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE20425
Domain Number 1 Region: 208-331
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.96e-33
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE20425   Protein: RP42218   Gene: WBGene00065430
Sequence length 476
Comment RP42218 WBGene00065430 locus:Cre-gld-1 status:Partially_confirmed
Sequence
MPSCTTPTFGVTSQLETQNAESPSRSSILTPTSLEDETSPRKRFPLIETNISASDRWPPA
PRRDGWSSVRAPPPARLSLHTNHRSMLSPISSAYSQTPNSLLSPTMFHPKTRSIFSPTLP
STPMSYGKSSMDKSLFSPTTTEPVEAEATVEYLAELVKEKKHLTLFPHMFVNVERLLDDE
IGRVRVALFQTEFPRVDLPEPAGDMVSITEKIYVPKNDYPDYNFVGRILGPRGMTAKQLE
QDTGCKIMVRGKGSMRDKSKESAHRGKANWEHLEDDLHVLVQCEDTENRVHLKLQAALEQ
VKKLLVPAPEGTDELKRKQLMELAIINGTYRPMKSPNPARMMTAVPLLSPTPIRSPGPVM
LSPTGTGVPTSTFGGSILFSSFQSPTLAGSNGMLGSNIFDYNLLSPSMFDSFSSLQLASD
LAFPKYPTTTSFVNSFPGLFTSASSTNSQNTTINNTQNMSPIPSSQSASSVNNTSF
Download sequence
Identical sequences E3MT54
CRE20425 31234.CRE20425 XP_003100676.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]