SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE21053 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE21053
Domain Number 1 Region: 86-138,171-234
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.88e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000665
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE21053   Protein: RP46201   Gene: WBGene00086540
Sequence length 249
Comment RP46201 WBGene00086540 status:Predicted
Sequence
MAMMTSQYSGNQASGDHNNNNLSSSESGVELKSLLSLIDNVYEMSPPTSDNQVNTDSESC
YQFQSRFKMSRIPPSGEFSIPGYVTMSETLLVPVKKYPKYNFVGRILGPRGMTVKQLEKE
TGCKIFVRGRASSLAANPVVKSKNRQSGPNNYNPLLNPNQCAKPSLSNISKCALTEEPLH
VFIECYNTPSVAEQKMIEAVEILQDLLSPPVDGKDELKRQQLVDISLINGTYRATSASND
YVRKLRSLG
Download sequence
Identical sequences E3NPN0
31234.CRE21053 XP_003089641.1.11157 CRE21053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]