SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE21277 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE21277
Domain Number 1 Region: 43-118
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 2 Region: 137-211
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000329
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE21277   Protein: RP26788   Gene: WBGene00069582
Sequence length 441
Comment RP26788 WBGene00069582 status:Partially_confirmed
Sequence
MGDDYSDDTKPSQQGVKRPQDATDGPANKKAHFGQEEEGGDHLSIKILIPSSAVGAIIGK
GGEAMRNLKNDNNCRVQMSKNSETYPGTSERICLVKGRLNNIMAVIESIQDKIREKCADQ
AGNDAFDHKNTSRGNEIKIVMPNTSAGMVIGKSGANIKDIREQFGCQIQVYPKAGSVEAK
TSLERVVTVAHEESAALLQAASRVLEKVASDPHHSSEINKEDFGKASGPNGASNTGGPTG
NQSQNAPFQQAPAFNGGGGGGGMNVGAAGFGGGQGGGYGGGGQGQFGGGGGGGPQFGNGN
PNQKYPMNGLGNNELLSFLDNLQSTLRTSGFNEQSVSEVMQAMQVLAKYNIMGLGLGLGV
AAMAQMRTGQESQMTANHGSAGFGDGYGGGVQGGGQGGGGQGGQGGPQGDQVRRLLDMME
PNGRGGDNDFREKRQASYWRR
Download sequence
Identical sequences E3MF80
31234.CRE21277 XP_003105327.1.11157 CRE21277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]