SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE21287 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE21287
Domain Number 1 Region: 519-592
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000182
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 2 Region: 605-679
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000013
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE21287   Protein: RP36476   Gene: WBGene00069595
Sequence length 1058
Comment RP36476 WBGene00069595 status:Predicted
Sequence
MAIERKREKKRNDFETRRRERESLLVKEEELPLDATPSRIKYSKRSGRRMMAIERDRLAK
KEKKRQYLEWKTKEMESRKPGNTVTIGTDLLKRIRFPSESVDGEVRTDKPKKKKTVKPNS
CDEPIKKKKKRDDKGRKSHQGDLPAVNTGGPIGNQSQNTPFQQATAFNGGGGGGGMNVGA
VGFGGGQGSRYGGGGSQFGNGNPMHFVPFQGNRQFNEQSVSEVMQAMQVLANHNILGLGF
GLGVAAMAQMRTGQESQMTANHGSAGFGDGHGDGGQGGQGGGPQGDQLSWRFVMAKGKQK
EPKFTADGRKKSKIGARRWRKKRAIERDRLAKKEKKRQDLEWKTKEIESRNSGDTVTIGT
DLLKRIRFPSESEDGEVRTDKPKKKKTVKTTRPTRHDLSLPPSSLNSSNSDEVSESRSKK
RKNSEMISEHQKEKKLKSSTKKQKERKQVENCDQPKKKMKKRGKEGQKSLQRDPRATNTG
GPIGNQSQNTPFQQAPAFNGGGGGGGMNVGSAGCVSDHLSIKILIPPSAVGAIIGKAGEA
MHSLKNGNNCRIQISKNNETYLGTSERICLVKGRLNNIMAVIESIQDKIRNTALYHKNTS
RGNKIRIMMPNSSAGIVIGKSGANMKDIRKQFGCQIKVYPKARSVKAKTSLERVVTVAHE
ESAALLQAASRVLEKVASDPHHSSEINKEDFGKASGPNGASNTGGPTGNQSQNAPFQQAP
AFNGGGGGGGMNVGAAGFGGGQGGGYGGGGPPFGNGNPMESFQFQGNRQFSEQSASEVMQ
AMQVSSRKSRGALGVGYVVFGLGVAAMAQMRTGQESEMTANHGSAGFGDGYGGGGQGGHG
GSQGDQVKRLLDIYMLIILPYFSLPGVNESREKLLSQSNPIELLLLLQPHLQCSIKKKRD
EKSQKSHQGDSRATNTGGPTGNQSQNAPFQQATAFNGGGGGGGMNVGSAGFGGGQGQFGG
YGCGGPQFGNGNPMESFSFHGNRQFNEQSVSEVMQAMQVLANHNILRLGFGVGVAAMAQM
RTGQESQMTANHGSAGFGDGYSGGVQGGGQGDQSHWRQ
Download sequence
Identical sequences E3MF91
XP_003105331.1.11157 31234.CRE21287 CRE21287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]