SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE21701 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE21701
Domain Number 1 Region: 34-207
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.6e-38
Family RNA methyltransferase FtsJ 0.00000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE21701   Protein: RP49248   Gene: WBGene00081899
Sequence length 208
Comment RP49248 WBGene00081899 status:Predicted
Sequence
MATRITNQKLSKSSRAWMREHLDDPFVKKAQKEGYRARAAYKLLEIQEKHKMIKPGMTVV
DLGAAPGSWSQIAGKLVGDKGLVIASDILEMDALPDVTFLQGDFREEEVFEKLLNILNGR
TVDVVISDMAPNTSGNRAVDQPRQIYLCELALDFANKVLGPKGQFLVKVFQGTGFDEFRK
HFVDIFDVLKTAKPAASRARSKEVFLIX
Download sequence
Identical sequences CRE21701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]