SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE22446 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CRE22446
Domain Number - Region: 358-424
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0185
Family Eukaryotic type KH-domain (KH-domain type I) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE22446   Protein: RP40408   Gene: WBGene00065330
Sequence length 523
Comment RP40408 WBGene00065330 status:Predicted
Sequence
MGKHRGGKKSSKKHRTHRHNSSSPRHSSKHHKSHRHSKNRERSTEREYIRRESSSTDERS
RRFGDTSSRDRTSTRHSDNHRQDDSPNGQGTSYQNNSHDLNVYRQEDGRRRFCETPPEDR
SPARHHECRKSDYHDKSHDKKSKNASRHHSSEKKHEKCDRKRRHNERDTSNQGRSSKRHH
SQERQEVNDTSSVDKIIPYGFEESDVKHRISESTRLHLNIPYVKQVTYCNLAYEKTEEPK
YIYIRGEDGMRQARNFIDDASIKGAQLNYEWSIKNSPEEEEWPETSFYYWTGHKHGRFFS
SPDCAAPIQEMEKKFDVSIEKVTDEPDLSKISGGYFREVKEQLDDLCHEYYLSHLFEEIK
VRTDLVKKMGEQGCDLAMLEDATDIVTDLTNGPGLIQTLTLFGYRDNVDHAIDLIDDIAK
RVDPRGEDIRIYEMKLSPREISNLMGEKNDEDEKLLKLIENTADVICYLNPNVLNGHQHL
MFQGTETNVSNAATLVFCAVTQGAVEITASEAREYLTEVRLDY
Download sequence
Identical sequences E3ME73
XP_003105547.1.11157 CRE22446 31234.CRE22446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]