SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE22447 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CRE22447
Domain Number - Region: 518-587
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000538
Family Eukaryotic type KH-domain (KH-domain type I) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE22447   Protein: RP44220   Gene: WBGene00065332
Sequence length 669
Comment RP44220 WBGene00065332 status:Predicted
Sequence
MIHQPCLFSEMNKYKIALLQYPCGFEEDQYPRAPRLDPRLVVGLLFPSQNVRERIREERE
EEKDRQRREKENRRRPVHLKPITDGNQLIREAEARRRERGGNDRSPRRRAHGDYESSRRR
PRRDSEENRREQPRRKRRRSRSPLQRDHERRAAGTTDSIKECKKEREEESQKKRKGPVSE
PLVEDGIILLEEIKGSRPTNSREPKQEHNRDSHNDSRSRSSVEDINLLLRQFEFDRRARR
AGDSNEPINEEESRRRPNSNKKKSSSLRRRAHGDYESSQNRHRKDSEDRRRQSRRSRSRS
PWQRSHEGRAANTTDPIRECNSEAEEESQRRSREHDKRTVGGKVLAMDGGMDEMEAQWTL
GKRYAHPISEYAKAACEEEGLIFQLRNTNSSWDQNAPSPVYNYLRFDGNFRGNVTIETIR
EDLDRISLREMKKRWPADVAIGPDEVAPYFIYHVPEGGYATFVRTKFHNDINSIMISSGA
AVLNMGNDENGPIRIAAKCLSEIEKAKKLLDEHFLNMIGPVTTETKKLRKSVQKIVQGGK
LYRIEEIQRTTATEIIVEYRKYGPCQKMTIEGTARNIARAVQEIKEITCKDVLEIDDIYE
IRINHEGRRGLLYRSCELLKRINNVITCKLDFEMNEPFGTIYFYGDKNQAEIGLRMINKR
WILSPDGGF
Download sequence
Identical sequences E3ME75
31234.CRE22447 CRE22447 XP_003105612.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]