SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE22927 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CRE22927
Domain Number - Region: 24-83
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 0.00144
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE22927   Protein: RP31421   Gene: WBGene00085591
Sequence length 121
Comment RP31421 WBGene00085591 status:Predicted
Sequence
MSLVFNQGAINRILFTLHFQKELPIVAHQKLMEMTGEEVMNLEQVTEFFKKIDNGEFRLE
EEVKEKPQVTLVQVLNVPDFVEQYLDIDTRLCLRKTCTTIRKIVNEKRLHIGCLNREIFW
N
Download sequence
Identical sequences E3MW56
31234.CRE22927 CRE22927 XP_003099606.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]