SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE23168 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE23168
Domain Number 1 Region: 205-328
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.2e-30
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE23168   Protein: RP42879   Gene: WBGene00071849
Sequence length 472
Comment RP42879 WBGene00071849 status:Predicted
Sequence
MPSCTTPTFGVTSQLETQNAESPSRSSILTPTSLEDETSPRKRFPLIETNISASDRWPPA
PRRDGWSSVRAPPPARLSLHTNHRSMLSPISSAYSQTPNSLLSPTMFHPKTRSIFSPTLP
STPMSYGKSSMDKSLFSPTTTEPVEAEATVEYLAELVKEKKHLTLFPHVFVNVERLLDDD
VRVALFQTEFPRVDWPEPAGDMVSITEKIYVPNNDYPDYNFVGRILGPRGMTAKQLEQDT
GCKIMVRGKESMRDKSKESAHRGKANWEHLEDDLHVLVHCEDTKNRVHLKLHTALEQVKK
LLVPAPKGTDELKGKQLMELAIINGTYRPMKSPNPARMMTAVPLLSPTPIRSPGPVMLSP
TGTGVPTSTFGGSILFSSFQSPTLAGSNGMLGSNIFDYNLPSMFDSFSSLQLTSDLAFPK
YPTTTSFVNSFPGLFTSASSTNSQNTLNNTQNMSPIPSGDSQSASSVNNTSF
Download sequence
Identical sequences E3NHU5
XP_003092034.1.11157 31234.CRE23168 CRE23168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]