SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE23454 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CRE23454
Domain Number - Region: 55-92
Classification Level Classification E-value
Superfamily IpsF-like 0.0101
Family IpsF-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE23454   Protein: RP36217   Gene: WBGene00083189
Sequence length 102
Comment RP36217 WBGene00083189 status:Predicted
Sequence
MNANQVSGLLTYQAYGTYSSGSVDNPPAGQTCKVYSAACLHATQQCTVTIYATMSTGSEE
ILCSDVDTDLTVVTINCATDETLAFMGRGPIVRFRCKFTNCM
Download sequence
Identical sequences E3MGT9
XP_003104592.1.11157 CRE23454 31234.CRE23454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]