SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE23554 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE23554
Domain Number 1 Region: 71-156
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000103
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 
Domain Number 2 Region: 13-79
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE23554   Protein: RP45165   Gene: WBGene00069006
Sequence length 180
Comment RP45165 WBGene00069006 status:Predicted
Sequence
MNSDIVYFPIHEHLDSSHLGQFIGHEGINIYKIEKENGVTLDICKNEEENSIVRLTGPYW
NLKCALNDVVELVTKIRNNNQRYKFKIPPKDVGFLIGKNGAKINEVKLSSNVDVHFDRSE
KPEKPDGEQEEDTDVFVTGNYQTILTGLRLICDRLSSKGQQTLYDDPRTLQFAESLMESF
Download sequence
Identical sequences E3MVS7
XP_003099755.1.11157 CRE23554 31234.CRE23554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]