SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE23697 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE23697
Domain Number 1 Region: 46-125
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.95e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00057
Further Details:      
 
Domain Number 2 Region: 240-310
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00062
Further Details:      
 
Domain Number 3 Region: 328-404
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000775
Family Eukaryotic type KH-domain (KH-domain type I) 0.00098
Further Details:      
 
Domain Number 4 Region: 139-215
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000409
Family Eukaryotic type KH-domain (KH-domain type I) 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE23697   Protein: RP43814   Gene: WBGene00069384
Sequence length 580
Comment RP43814 WBGene00069384 status:Predicted
Sequence
MNAVNSNTIQIIADGGVGTLKRPLDSELLDGDLIPAKKTSEIGDLNMGDTDKIIEIYQVP
EKVVGLVIGKGGSEIRLIQQTSGCRVQMDPDHQSVNGIRNCTIEGPPDQVAIAKQMITQC
FFQVISRNQTGVPQTVATGEVTEEMLIPADKIGLVIGKGGDTIRTLQDQSGLRLLNVVQD
SSSATGQPKPLRMVGTPAAIETAKALVHNIMNSSPGNPPLLPRGGQSSGGQYGGYGGQEA
KGEVIVPRVSAGMIIGKGGEMIKRLAMETGTKIQFKPDANPNSEDRVAVIMGTRDQIYRA
TERITEIVNRAIKNGQAGSGSILGGNNILGQSTFYMHVPATKCGLVIGKGGENIKQIERD
SGASCGLAAASEQKNEDEKVFEIKGTQYQIHHASHLVKIKVGEIAPNTPVPPLPGSGYQQ
HPQGMYGSAAQSGGYPTGVQGGFIQQQQPQTQQYGKGLMDFSCSHSGFTGIPQQQQWAPS
NGNGAQQHVSNDMYHNTIQQSHAVPATVVIPQGSTDPTPAVNPSTGAPDYSAQWAAYYRS
IGLVEQAAMVENQMRRNQATGGPTGDVPGAQQGHQAYYSQ
Download sequence
Identical sequences E3N9B4
CRE23697 31234.CRE23697 XP_003094996.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]