SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE23698 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE23698
Domain Number 1 Region: 157-215
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000147
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Weak hits

Sequence:  CRE23698
Domain Number - Region: 52-92
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000114
Family Eukaryotic type KH-domain (KH-domain type I) 0.0063
Further Details:      
 
Domain Number - Region: 118-177
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 0.0432
Family Creatinase/aminopeptidase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE23698   Protein: RP06486   Gene: WBGene00069385
Sequence length 273
Comment RP06486 WBGene00069385 status:Predicted
Sequence
MGKLTNCLIAAMIASPFVIKYLRHRRLFKFVRMKPQLEETESGTEVPELPQDHYIRIPAF
AVPAVIGKRGMTLRKLMYDSQTECVLRSYKPEELDVSIDEIIPDTEWSEKFETDDWFAEA
SEEARHKITYLLVRTSDTRKLQMVRLRIAEIIEVIQKPWKSAEFEVESHMVGYLVGRGGR
NIKSLRDKFTVQIQISDPIPDNPSRSIVTVRGRDLTALKEVEIVMKETVLPKNYNRVPKF
DEDTLVENGIYENVEEELEDLRRAGELLSQGFF
Download sequence
Identical sequences E3N9B5
31234.CRE23698 CRE23698 XP_003095007.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]