SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE25381 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE25381
Domain Number 1 Region: 149-196
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000438
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Weak hits

Sequence:  CRE25381
Domain Number - Region: 16-75
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0291
Family DBL homology domain (DH-domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE25381   Protein: RP32604   Gene: WBGene00054700
Sequence length 199
Comment RP32604 WBGene00054700 status:Predicted
Sequence
MSNQDSPTNRPNGSYLDELMKELHSMTNIYESNNIAKFRNAQNLLIREIQRVLDAELLLN
NLGSRMTSGTPRVEAGRETGLSSIELSRNGNRWKEESKFMTPSPAPGSSKFRQSFSPLTL
SLIGGGGGSSPHSGKEVDEDDEGKIEKRDKLYFPEGTKNNANPIGRLIGPRGITIRQLEK
DLGCKLFIRGKGEYFDNFD
Download sequence
Identical sequences E3LSU9
XP_003113161.1.11157 CRE25381 31234.CRE25381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]