SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE26806 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE26806
Domain Number 1 Region: 150-245
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.28e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 2 Region: 70-142
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.82e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000848
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE26806   Protein: RP47786   Gene: WBGene00071288
Sequence length 436
Comment RP47786 WBGene00071288 locus:Cre-pes-4 status:Partially_confirmed
Sequence
MDPAMYPGASAANYLTYPQQATTDYLGAYAAQTATTTRNANGSSASSDQFGDPSAASSSS
PRETSPSTTSLVLTIRLLMQGKEVGSIIGKKGDQIKKIREESGAKINISDGSCPERIVTI
TGTLGVIGKAFNMVCNKFEEDMLLLPNSVPKPPITMRVIVPATQCGSLIGKGGSKIKDIR
EATGASIQVASEMLPHSTERAVTLSGTADAINLCMTQVCQILLEAPPKGSTITYRPKPTF
NPLAIATSAATIAAQQQQAQAQQQLAAAAMLGGSQGVQVQQQLVTNALLQQHQLANYQQE
LARAALLNQQFLMPGQVSTAQQQASNAQEVYLGQHGLIYTTGGAQLGAQTAESKAMEAGA
AAAAAAQWQGYDMAAVQQQQQQQQLLNQYALNQSMLIGAPFMKGGPTPPGTSSGKATSSG
SSGASGATSSARFHPY
Download sequence
Identical sequences E3NGC2
CRE26806 XP_003092563.1.11157 31234.CRE26806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]