SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE28190 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE28190
Domain Number 1 Region: 132-243
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.28e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE28190   Protein: RP36818   Gene: WBGene00056195
Sequence length 324
Comment RP36818 WBGene00056195 status:Predicted
Sequence
MDPYQQGGRGGGYPSRGGRGGGGGGHMGYPPDQGNYGGAPAYGGYDPYNPYAQGGYGMYP
GGGSYPPQEMPSPLDAEIQAVLREIHSEVAGLESSGEQFRNARRLLNSEKEKLENNIDPE
WLEVDVAKPVKVCKKILIPIYRHPSFNFIGKVLGPKGATLQTLCKTHKCHIYILGRGSTK
DREKEAELLTSGDPQHAHFSGPLHVKVETVAPAYIAYGRVAAVIEELSRILQPIHEDTTP
AHLKNGTGGEGDEKNDDERKDDDGSGRGGRGGGRGGFRGGFRGGRGGGFGGGPRGSGGPG
GPMMGGRGGMGRGRGGQPAGFRPY
Download sequence
Identical sequences E3LMT5
31234.CRE28190 CRE28190 XP_003114872.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]