SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE28506 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE28506
Domain Number 1 Region: 130-252
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.5e-34
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE28506   Protein: RP36317   Gene: WBGene00056177
Sequence length 444
Comment RP36317 WBGene00056177 locus:Cre-asd-2 status:Predicted
Sequence
MLDGHSDDQCLLNLDTSSGVVPPPPNDTGHEFIGPSSGPPQVTITPSPVSHQPGGANGIS
TTQHPQYSVEYLSQLLKDKKQLAAFPNVFHHLERLADDEISKVRVALFQFEFTKDNVTLP
DAEGDITVHTEKVFVPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKK
KEELNRGKPNWEHLSEELHVLIQCEDTANRAKVKLLRAMDEVKKLLVPAPEGEDELKRKQ
LMELAIINGTYRSGADQSALAAAHLAAVKQQQPLAALQAAALQRGVMANGIQMMANGISR
SPTMAVCGAPIVMSPSGRAASAGATATSQAALIMQQQSQLQANAGNAALQQQAALLQQQQ
AAEYQQILLNQASLYDFSAIQQYAAGQNAVAAAQAQAQAQYGALAAAAAANSAQAGQQQY
ADYAGVDLTSQQSAHGGYYVRRWA
Download sequence
Identical sequences E3LMV5
31234.CRE28506 CRE28506 XP_003115053.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]