SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE28699 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE28699
Domain Number 1 Region: 1086-1190
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000263
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 931-1015
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.00093
Further Details:      
 
Domain Number 3 Region: 1302-1368
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 4 Region: 1226-1299
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000336
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 5 Region: 795-853
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000143
Family Eukaryotic type KH-domain (KH-domain type I) 0.0048
Further Details:      
 
Domain Number 6 Region: 1015-1080
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000862
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE28699   Protein: RP32563   Gene: WBGene00067795
Sequence length 1472
Comment RP32563 WBGene00067795 status:Partially_confirmed
Sequence
MTKSDVENEVKEDISTRKKRTARTQSSRIWSSGNTSYEQYTGVKFKCKVCLASVPQHILS
HMERWWERQMILVALVMTGHRTKEEAKKEYQASIRNYRKGFKIHLGSGYFYVCRDHLAHA
GKCWMDILKIKSPDDVMKAKKPAVKMSMDIMKYFNDREFNFKSEKAFLEHCDQFISYDWQ
RICEIYPHLSEVLEEMEEMEDVPASLQEINVQEYENDENNVVLSPTQEISEYDDTMELFE
PVMDMAKEEPESKQEITLPEPPVNLIKKGKVCKICGERVVKGHDISSDWTRRIVIYMAYQ
KGYIGKERVFTLFYQTNRIFICPEHSREAVEEIYELFGTRDPTNFIKMYSSYKQNVETTF
KDIRFCFGLDPAEKIEKFIKGARSFASIHRIDVDKPPAPSTSPILRPPTPKLLPRISGNI
EIPKRLSDILALEIPKSPPTAVDTPVPTHPASALWMLSTREPPSAPNRETSRHSERRTRP
YPNTSRYASVVEFCSPSREGLNRAVRRLSSIRRGVCIPSSSQESSYSDPRICILNDGPPE
DTCPRPKTVKSRNQCQICKARNVEEVVTLSIFTEIVCVFVVLMNSQQWTESRVMEMYSER
VKQKSGVIVMSERKRFLNVKQEDSDSLPGAKRSFNDYSNDYSPRSPSPIRSPSNSEFSPC
TQSPSSPSPLEPVKPVVKTGKIEKSSVEVPEKFLEEVRERVDMLQKETFCTINVSSRITG
LTRTVFLEGLRENIITTKDRIEEIVMSSIGFVHQVARKHLKRGYPDYLTPRSPSPESPEE
KQKPIRKRVSINIPASKFQCYLIVGKCGATVKKLEMDTRCEISVYKELENIEISGLEEDV
ERAKILVNDIFAASAALRKATAKPQGENGSVIQELKIPSHLSSGYGFTMMKKKANEICLK
SDVRWQFQDMEVGKLMRLLGKREQVEKVIKEIEEFLEIMDVSEDTMFIHSSKVAKIIGKN
GETIKSLSKRSGAECHFNRYDQNGPMPTFQTLVIKGSKQQISTARQMVQELINAVYHLPI
PLNVYYGVAGYENENIINISEVSGARCTCCPDSKDQKKKVIKIEGTEEQVELAKNLLECS
IEIEEAKVFTVDTLKISVWKASFVIGKNGSTLSSIRKESGAECIMKTEEDGYKILEIRGT
FKQVEHAKRLIREQIGEKQVVHRVDIPFHVYPAIIGNNNEKVTEISAASGATCCPNEDQR
KKFIKIEGTVEQVDKAISLLKDSIEKNETKTTVSSMTVPISKCGLVIGKRYERLNSICNE
SGADCTLSVATETEQTFEIRGTTEQIARATGIIETIIEDRHQMSYTMFVPAKLAGKIIGL
NAVTIDSIRKESGTKIKYDPRRLEETMKKFEITGTVKQIETAKTLMQEASGIVLLGLPQD
MDYVWNGYETGMPMSNWAPLESAPPPPPPPPLMLRLTPPPPPPSPRRSFRPFPPPPPPPF
SSSFNHNYPGPSRSYNYPHHPYQPFGPSQFYR
Download sequence
Identical sequences E3MK30
CRE28699 31234.CRE28699 XP_003103433.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]