SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE28701 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE28701
Domain Number 1 Region: 295-386
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000336
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Domain Number 2 Region: 369-455
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 
Domain Number 3 Region: 240-315
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000131
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Domain Number 4 Region: 186-234
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0053
Further Details:      
 
Domain Number 5 Region: 67-115
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000877
Family Eukaryotic type KH-domain (KH-domain type I) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE28701   Protein: RP32486   Gene: WBGene00083810
Sequence length 489
Comment RP32486 WBGene00083810 status:Partially_confirmed
Sequence
MSERKRTLDDGDKLTPAVKRALIEDSPSAAPISQESSTSTSLARPRTEEIKKSSTEVPER
FLNSVSENIHELQMETECNVYISPDITGLTRTVYLQGFKSDIQYAKDRIEELVMSSIGFE
PQVSRYEIYKKAHINMYSPRSPSPIRTSSSTQYSPCGAEEPEENEEEHISIEIPASETQC
ILITEKFGDTLRRLEKATDCAVYTHRERGVIQVTGNNKENVEKAQDKIIELITSSKTPSP
EARVSRDMSVPSVFHTKIRGSKRQTFEDICKEHDVQWRLKSFEGSRNEMPIRLTGKEEQV
EMVMKEVMELMSELRQEEIIVHSAIVSKVTGANGEMLKLIQEESSALCVFDSETLDDPAE
MQKILRIGGTASQVSAAKKMVLDLTDTNARVFLNIPFAVYDAVMGENYKNIKHISEVSGA
DCSNAIATERKKVIRIEGKAAQVEHAKALLQKLIEAEEAKAKNVDTLVPLTSLILPPPPP
PPELPPINP
Download sequence
Identical sequences E3MK32
XP_003103536.1.11157 31234.CRE28701 CRE28701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]