SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE28702 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE28702
Domain Number 1 Region: 296-386
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000111
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 196-263
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000657
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 
Domain Number 3 Region: 390-457
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000076
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 4 Region: 483-532
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 5 Region: 83-131
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000365
Family Eukaryotic type KH-domain (KH-domain type I) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE28702   Protein: RP12599   Gene: WBGene00067794
Sequence length 569
Comment RP12599 WBGene00067794 status:Partially_confirmed
Sequence
MSERKRCLSDGEIEDSDSESVPAPKRTLSSVIDYSNYYSPRSPSQNAPSLPNSPPLSPRR
PTPQKVKKSSVEVPEKFLDSVHRRIHELQQETECNVYISTQITGWTRTVYLEGFQEDIEY
ARDRIEEIVMSSDGFEHQIATKHLKFGDGLSPRSPSPIRSSKNVQYSPLATPTVTPEKEV
SVEISATQYQCYLATGKCGATVRKLEMETKCSILIQDEEETIRISGLEENVERAKKLVNE
IIAPVSPKREITIPSGLYGEFGSRQREQTIDILKRNGVNWNVPDAAAEKLVMKLSGNEEN
VEKAIKEIEELKKNLEYEMLIHTTKVSRVIGKNGETIQLIREKSGAVCHFDKKTRDNPRL
SLKTMIIKGSETQIETAKQMIQELIDLAKYYVDVPFRIYDNVIGENGENIKKISKVSGAK
CWIDKQAIQQKKRVRIVGTSEQVEHAKRLFLDLINTEKRIKDNTYTMLIPIPAFEQITEL
GFRSIGRQSGAKIHYNSKTAGGAVKKITISGEKDQVESAKRLIQEAVNNVWNNYSQISQN
YPLPRNPDSPSTPHSIPVLPVPHNPYALN
Download sequence
Identical sequences E3MK33
XP_003103408.1.11157 CRE28702 31234.CRE28702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]