SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE28807 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE28807
Domain Number 1 Region: 193-266
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 2 Region: 95-172
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000657
Family Eukaryotic type KH-domain (KH-domain type I) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE28807   Protein: RP38502   Gene: WBGene00067770
Sequence length 335
Comment RP38502 WBGene00067770 status:Predicted
Sequence
MRPADVASRNKTKEIVHSKKKRLVIIQHLLILLKIFFFQNPQRRLMIRRRQEKKNDLVQS
KSEGTKKQTPPHAKVQNSNNDPANKKAHEGKGEKDGENLSIKILIPSSTMYAIIGSSRDA
VMRNLIKEHCCQIQIQASKTTPATSERICLVKGRLDNILVVIESIQKIVREECGDERGND
AFDFDNTPRSNEIKIVMPYTLARKVVGKAGDSIKSIRKDCGCIIEVCPKVGIMEADTSLD
RVVTVAHEDSATLLKSVARVFRKVAKKREEDREEKEPSLLCWVSREMCFKRLREEYFLTG
EVGGCPTPTRGHPTADEVRKWATDYEEMRNFFFFS
Download sequence
Identical sequences E3MK71
CRE28807 XP_003103503.1.11157 31234.CRE28807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]