SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE30359 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE30359
Domain Number 1 Region: 90-228
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.17e-27
Family DsbC/DsbG C-terminal domain-like 0.002
Further Details:      
 
Domain Number 2 Region: 26-81
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.0000000000188
Family DsbC/DsbG N-terminal domain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE30359   Protein: RP50102   Gene: WBGene00077215
Sequence length 233
Comment RP50102 WBGene00077215 status:Predicted
Sequence
MLKQFIALSLSLAFCTAGFASVETVKAKLAQQYPNVKINNLQTTEMQGLYSGTLDSQIVY
VNEDAQHLFIGSMIRLKDQHNLTKDLAVKENTIDFKALPLNDAVKTVRGNGKRQLAIFSD
PNCPYCKTLEGNLAKLNDVTIYTFIYSIKAQSILPSKQVWCSANKEYAWKNLIQNGIKPT
APANCATPIERNLELGKKLGLHGTPAIIFSNGYKVMGAYPAEEIEKIWKNFGL
Download sequence
Identical sequences A0A072CXK8 E3NX43 N8TIM2
CRE30359 WP_004718953.1.15248 WP_004718953.1.25018 WP_004718953.1.53393 WP_004718953.1.55951 XP_003087029.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]