SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE30686 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE30686
Domain Number 1 Region: 132-229
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00026
Further Details:      
 
Domain Number 2 Region: 42-123
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.21e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00067
Further Details:      
 
Domain Number 3 Region: 234-307
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.06e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00044
Further Details:      
 
Domain Number 4 Region: 311-392
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.2e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE30686   Protein: RP29845   Gene: WBGene00059096
Sequence length 597
Comment RP29845 WBGene00059096 status:Partially_confirmed
Sequence
MEGFNPQQPTQPASLKRDRPEDDEYGIPTKRVAEDADLTLGNPYMDDNETVNEKYPIPES
AVGIVIGRGGSEIQGIQAKAGCRVQMSSDNDNSGVRQVTLEGSRANVEAAKVLINEVVAR
SQTPRPQYGFPRAQNTIDIPIPPNRCGLIIGKAGETIRQLQEKSGCKMILVQENQSISDQ
AKPLRITGDPQKIEIAKQLVADILNSGGDGNGGSGLQMHHQGGGGGGGASARGEVVVPRS
SVGIIIGKQGDTIKRLAMETGTKIQFKPDDDPTTEERTAIVMGTREQIYRATERITELVR
KSTQQQGGGNMGGGVANDASTFFMSVPAAKCGLVIGKGGETIKQINAESGAHCELSRDAN
ASPDEKVFVIKGGRRQIEHAKHLIRIKVGDIPPNTPFRDDSAMSMQPQFNAPAQAAYGGQ
QQWNPAAAQIPAATQNPYQVQGGGGWAQNQVFAQQQVAAAAVAAAPYASAGIIPAQAQQV
AYQQPQVVQQQPQAAAATVTPSVDPVTGEQDYSAQWMEYYKSIGAHDKAEAVEAQMKKKK
AEAAARVAGSVGMVQQVPMGMAMQQMAGQARAPAQAYPAYSAAGGVAYQPQQYQQYQ
Download sequence
Identical sequences E3LTR1
CRE30686 XP_003112693.1.11157 31234.CRE30686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]