SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE03667 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE03667
Domain Number 1 Region: 38-265
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.12e-65
Family BAR domain 0.000000912
Further Details:      
 
Domain Number 2 Region: 317-398
Classification Level Classification E-value
Superfamily SH3-domain 5.64e-23
Family SH3-domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE03667   Protein: RP02956   Gene: WBGene00060431
Sequence length 402
Comment RP02956 WBGene00060431 locus:Cre-unc-57 status:Partially_confirmed
Sequence
MLSLFFMFLILVYLFPINILRVKSFRIMSFSGLRKQFNKANQYLSETMGAAEPTKLDDVF
NDMEKNIDTTYNLVTDLVAGTNEYLQPNPATRAKMATQVALSKVRGTTKTSPYPQTEGML
ADVMQKYGQQLGENSDLGKALNDAAEGYRQMADIKYQMEDNVKQNFLDPLMHLQNNELKD
VNHHRTKLKGRRLDYDCKKRQQRRDDEMIQAEEKLEESKRLAEMSMFNVLSNDVEQISQL
RALIEAQLDFHRQTAQCLENLQQQLGHRIKDAGSRPREEHVPLPVLGNESRTPRSRSPAP
SEMTHNSVPSSVAQNGGGMPQAPPAYQGPPPGGLPPPLSQQQKPQCRALFDFDAQSEGEL
DFKEGTLIELVSQIDENWYEGRFNGKTGLFPVTYVQVLVPLK
Download sequence
Identical sequences E3LXK8
31234.CRE03667 CRE03667 XP_003111356.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]