SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE05409 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE05409
Domain Number 1 Region: 391-581
Classification Level Classification E-value
Superfamily Fibronectin type III 3.55e-30
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 2 Region: 234-334
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.49e-21
Family Voltage-gated potassium channels 0.0045
Further Details:      
 
Domain Number 3 Region: 30-62,120-216
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.37e-18
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE05409   Protein: RP18425   Gene: WBGene00052882
Sequence length 614
Comment RP18425 WBGene00052882 locus:Cre-twk-32 status:Predicted
Sequence
MCGGALLSSGLCRFSELTPGQFGLTKQLVFRLALPHITLLVVSILYAVFGGWMLTLIKYS
QQTTHQAIMFDQTRQSFAKKLAGIGDKADFETIVNELVEKTYEFYTMEDGHRWQEAAFNS
NPLTNFTSNLFFAATTLTSIGYGIDAPESLVGRVFCLVYLFFGIPLYLITIADMAKFCTE
LMNRTYTEIIKYKYRVKRRYKRWKSGRIRRESMKVGQVIIAGGEDEVAEFLWTHLEHAQF
VEVPFLLVIGILLLYIGLSSWIISWVENWNMTDGFYFVMMSVLTIGFGDLVPRNEIFAVP
ILFIILAGLVLTTTCVDVVGAYYIDRLHFFGRRLDDDPLSWLKEVQQRRIEAMKKEAMRK
LFETVTALHHIRLTAFKQLTQNYDDHLRSKAPDPPRHLVASHATADSVMLRWSAPIYVDE
GKRYWYTITYKPRTPQRRNNVVAVDFINKDRYLVTGLKSFTLYEFSVYVTTRYGQSVPIK
VQEYTEPCTVPQSVRIDAISDETATISWRAPKMNNGPESYIIQFVQEPAPQFVYWNKYRV
GSSTRFTLTDLHADTRYIICVTAEHNHGLAAMSKSMRFRTKKWWGDEDSTCLRIPGTSHR
LSIASAISTLTALR
Download sequence
Identical sequences E3M0E7
31234.CRE05409 CRE05409 XP_003110496.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]