SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE07506 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE07506
Domain Number 1 Region: 48-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000348
Family I set domains 0.05
Further Details:      
 
Domain Number 2 Region: 130-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000549
Family EGF-type module 0.042
Further Details:      
 
Weak hits

Sequence:  CRE07506
Domain Number - Region: 8-63
Classification Level Classification E-value
Superfamily gp120 core 0.0051
Family gp120 core 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE07506   Protein: RP07069   Gene: WBGene00058285
Sequence length 263
Comment RP07069 WBGene00058285 status:Predicted
Sequence
MSGLFNMNCHILIIVFVYLSVLFQITIAGEHILRLEENIHSGTTLIGVEQGSSVLIRCEH
PKDKTGSLRWLRGGTAIDPAYVKTKKDASYVEITDYQPDKDDGVYECSAPGMSASYRLKG
EKKHILPDGFRLCYGEEMASCKHADQCHVETSTGHFSCVCEIGWMGAACDMISDPVRVHP
VITPPVCAYWPPVVTLLVFIIIIVLLAYCLYKFKVRNPHHYSKYTTTTINNNSVAKPPMV
SGEYTAVHQQPSGPKNGDVANMV
Download sequence
Identical sequences E3M220
XP_003109647.1.11157 CRE07506 31234.CRE07506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]