SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE20803 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE20803
Domain Number 1 Region: 3-155
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-25
Family Phosphotyrosine-binding domain (PTB) 0.0039
Further Details:      
 
Domain Number 2 Region: 206-312
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-20
Family SH2 domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE20803   Protein: RP19149   Gene: WBGene00060972
Sequence length 323
Comment RP19149 WBGene00060972 locus:Cre-shc-1 status:Predicted
Sequence
MPDVDPRFSQELRSSGVTLAAVYLGSVPVIESMNSVVSQMRSQVVAECIQHVAATVGQCE
AQEINPIVGRIIGEVKEENYVVDLNISSKMVKVIKKNRLIQRHPITYFSFGCRGRGENSN
MFGYIAKNKDGTDRRCHVLSSKDAQKLVDTLIAAINVSMTDTRGTPSTSSTPSDDGFVKP
EVPAEGRIVNLVRQSPVGSHRQVSDDVVGKVWFHGHLSRDDAQSLLTTAGDFLVRQSDHT
SGKFVLSGLTTDGDHKHLILLDHQMRVRTRDHEFNNITELIDYHMTNGIAVRTERNAKGE
TSIMLLRPVPAPAEVPPSPESPN
Download sequence
Identical sequences E3MFM3
CRE20803 31234.CRE20803 XP_003105077.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]