SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE26263 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE26263
Domain Number 1 Region: 350-578
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.37e-35
Family DBL homology domain (DH-domain) 0.00056
Further Details:      
 
Domain Number 2 Region: 209-295
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000189
Family DNA ligase 0.065
Further Details:      
 
Domain Number 3 Region: 111-190
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000741
Family DNA ligase 0.022
Further Details:      
 
Weak hits

Sequence:  CRE26263
Domain Number - Region: 607-681
Classification Level Classification E-value
Superfamily PH domain-like 0.0765
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE26263   Protein: RP38069   Gene: WBGene00054106
Sequence length 960
Comment RP38069 WBGene00054106 locus:Cre-ect-2 status:Predicted
Sequence
MDVSMLQSQQKHSRNMRKLAVWKGDIEEYKEIFDMINQQKEKRKVEVVPYENLDELGSDW
SEYTFFCGDFTSDLFHTLTNVEDSDASVLIVGPAVLKHKLQTAQDFMLLRPCRPLYCELM
KNVTMKLSTEVMNKRALVDMVHFMGGSVRKDTVQRTNVFIAAKVEGKVQSMTLVGVPTLR
ADWITECWKNRDDPYFDVFEQDFIDKHSLGVFEGLRLYFHGFKKDEIDDMKINFNNTKGT
LVDDPSKATHVVYNTINDDIEPLPVASNRVHVTQEWFWVSLHRGCCALEDNFALPTGSLL
RKSLDYRDINSPLGISSRSNNSRSLSSMRDCSGEGPSSNMTPDYVYSNDDEENICKSPRQ
PSKRLRVCMEMVETEKNYVDLLKLVVKFKQALETEISQNEFMRRTDVAMIFGRFDPILEL
HEKICERLTTVLNEANNLLSAANGSKNDDRNLDFSQVWIDAKEEMKRAYPQYLNSFDTIR
GLFDKHDKENSKFHTFCKAKESSPEFHRLKLADLMIKPVQRLPSVILLLNEMAKKSDFKL
KSTAELASKAIDEVLKTANKILEKNDNLICHFSKFTDIESIPPILVAANRMFIRELVVSP
IASTSSRLSQFPKMKLFLFHDVLVITKVRSEKNAMQRFARHASFVSLQAKKRRPYKYIDH
IQLITMRSAFRIRAPDDVFKFLEARSHVHGTKPEGFGFLVYFVFSDLFVWCLIHRDEQGG
DTETVFESTDSKEVRDFLDDIHLKIMINCGRDFFLPDPFEVDDLNDAQVADLTNRFFRRL
CGSKVQNGHGSQMSITELSHNETVMGPPKLQSRMRRALSNAQLTITSTLGFGRNRNNFTR
INENASFMTSPRVPCDPAALAKVPSIGMPGENSDSTPKRGHRYVLLYKYMFSSVISALHS
LRLHSIELELMEEADRHTYYLTRSRNRLAHEFHLISTHSFNHWLFAFYNRKFYTTRSLIE
Download sequence
Identical sequences E3LR19
XP_003113526.1.11157 CRE26263 31234.CRE26263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]