SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE27285 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE27285
Domain Number 1 Region: 224-399
Classification Level Classification E-value
Superfamily MIR domain 1.7e-39
Family MIR domain 0.001
Further Details:      
 
Domain Number 2 Region: 1079-1212
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-21
Family SPRY domain 0.015
Further Details:      
 
Domain Number 3 Region: 4314-4392
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000536
Family Calmodulin-like 0.038
Further Details:      
 
Domain Number 4 Region: 670-800
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000257
Family SPRY domain 0.044
Further Details:      
 
Domain Number 5 Region: 108-188
Classification Level Classification E-value
Superfamily MIR domain 0.0000000262
Family MIR domain 0.02
Further Details:      
 
Domain Number 6 Region: 2277-2357
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000122
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Weak hits

Sequence:  CRE27285
Domain Number - Region: 436-543
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00183
Family IP3 receptor type 1 binding core, domain 2 0.01
Further Details:      
 
Domain Number - Region: 1554-1678
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00464
Family SPRY domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE27285   Protein: RP50199   Gene: WBGene00052257
Sequence length 5220
Comment RP50199 WBGene00052257 locus:Cre-unc-68 status:Partially_confirmed
Sequence
MDFDFTDISDEDHNYVTKGDIVCLSCLTSHSKEGVQGSERVCLCTEGFGNRMCTLENVAD
KDIPPDIAMCMLYIDNALSMRALQEMMSAESDHVSKSASGAGGHKTLLYGHAVQLKHVQS
EMYLACLSSCSSNDKLAFDVGVQETNEGEACWWTIHPASKQRSEGEKVRVGDDVILVSVA
TERYLHMAYNKGYMVIASFHQTLWNIQSVSSGSMRTRNMGFLFGNDVLRLFHGNDECLTI
PENWSEHPQHNMVIYEGGAAVTQARSLWRVELVRMKWHGALVGWEQVFRIKHITSGRYLG
VLDNAVQLYHKEKADFDLTAFVMCQNKDPKKQMLEEKEEEGMGTATIRYGETNAFIQHVK
TQLWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFFMALEEESKSARVIRKCSSVL
NKFLKGIDALRELGNQSPDWTRVDLNEVLKLMEDLIEYFAQPHEEQEFEDKQNHLRALRS
RQDLFQEEGVLNMILDTIDKFSQMEALPDFAGLIGEETQIMWEQISTYLYLLVAAMIKGN
HYNCAQFASAQRLDWLFGRLSNPQSAEGILDVLYCVLTESPEALNMINEGHIRSVISLLE
KVGRDPKVLDVLSSLCEGNGMAVRSSQNLITQYLLPGKDLLLQTSMRDHVSSMMPNVMLG
VVEGSALFRKWYFEAEVEHIETMTKQAPYLRIGWANSVGFKPFPGSGDKWGCNGVGDDFY
SYGFDGKSMFFGGKSRVVGHKLLEKGDVIGCSIDLTIPEIRFSVNGTYMSGTFKKFNIDG
YFFPVMSLSAKVSCRFILGGNQGRLRYGPPTGFSAVVEAVNGELGISDCLSFGDLGKNIF
CGPQTIFNNLEPFIPTPIDVSTTQLTHHAIEKHHSYAENLHELWAMRKIELGWSYGENRS
ETSRKHPCLTKFELLPETEKKYNIMLALTTMKTIEALGYHLITDDPPCRLRAVRLGPNFQ
QPNGYKPGPLDTHEITLPAELQPLTEALARNTHNVWAKEKIKRGWTFGLSEHVDATQKRS
PHLVPYEQVDERIKQANRESAAENIKALQLFGIFLEPPAHEHDEIAEKELRARKDNTRTY
RAEATYAVNGGKWYFEFEILTAGFMKIGWMDIGSTPEIQLGADDRSYAFDGYLGRKWHQG
AETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLVPAMTLG
SGQRGRLNFGQQSNSLKFFTTCGLQEGYEPFCVNMYRTMPMWFAKQLPRFEDISTLKSGS
ILEVSRFPATGNSPPCLKILQKVTISEGGPSEKAKMEYIRLSLPVKCNDTFVKNKDKEAI
RRQLQDYKERSQSVVSQIRAPTIPKEFDDNKEKKGFLRSMLGSKDSHESDDDRRSRTTSK
QPSMEGDEPPAVRRSLLELPHEERQIAEDHLRDMSDRHAEKPKKGGLLSRLRDSSNTRKK
DSDRRKEDKAAALRQMKSNSRSFDAGSLDTSTLPTGQKDVLASSEMPLSGPGRQLTIKRG
SIKKNKKGKKGEHALEKIEREKKGSIIPPEAQMDVLQVGDGPALIALKDKVDEYYYGLRI
FPGQDPSQVWVGWVTTQYHYYNLNFDGSQGVRKCRFSEADHHGTTVDSVQSQNCYMVNVS
ELLATTPDVANTKVSGTLIGCIIDTSIGELSFQVGTTDTGIKFKLEPGAMLFPAAFVTPT
ATEVVQFELGRVKFTFPLSAAMFKSCEKSLVPFCPPRLTVEQIESIYWARVPNETLRTTA
LKLSEVRGWSVLCNDPVRIMSVYIPEKDQSLDILEMIEMPDMLEFHRQTLNLYCKLASHG
NHKVAHTLCQHIDEDQIMYAIKSHYLSGPMRQGFHDLLIGLHLMSHTAARNSMAKEYVIP
LVPQLQIKNVLDPDSESRYPQITGQSVSMLSQMASEPVKKHISREEEMKLLPPSVDFEAL
KKHVMESLQSATHHAVMNCRDLIGGDNTNHFEPLFKLFDQLLVIGLINDEELECLLRLIH
PQAFDESYENGTTQKGLTQLELAEPVKLQLVSILDHLCDIQLRYRIESLVAFTEGFVGEL
QSDQCKRYMEIKQTDMPPAEAAKKTKEFRCPPKEQMFRLLMCKVKEERDPEIMEEDVDVD
QCPMAESLQQQLRDFCELLVAKIGNAKEGDSEEQLALIESEEGSWVDSFARIVVKVPPPL
QEEGMEMQKKGTQNFREIIVTMLREWAQADFIESKDLIRCMFKLLLRQYSGIREIRDAMS
QAYVFHERNAEDVTDFIVYLIQIRELLTVQFEHTEEAILKRGLWKLMNNRIFFQHPDLMR
LLSVHENVMSIMMNILTAQQGTVEHEGDEVKEKAPIKDASEMVVACSRFLCYFCRTSRQN
QKAMFEHLSFLLDNATMLLARPSLRGSVPLDVAYSSFMDNNELALALKEEELDKVAVYLS
RCGLQPNSELITKGYPDIGWDPVEGERYIDFLRFCVWINGENVEENANLVIRLLIRRPEC
LGVALKGEGQGLFSAFKEAIALSEDIRLLENDSHPAMLTSGLLGENPTYPSKEIEGEDYI
DLGAATLDFYSSLVDLLAKCAPDPMAIQAGKGDSLRARAILRSLISLDDLGQILALRFTI
PNLAAPSIEAVRRANAVQASHTQKAVMAHTFAMVASLASEVSNTRRSQTFTSGANLARRG
LPCVEEVDTDDSKSSDYASVHTSFSSGNELFVPKSEKEKAELQLLNEKKYPIVQRRRSSR
YNPIDNTGPLPGLLPNHKGSVLLFLDRVYGIDQQDMLFHFLEQSFLPDLRAATMMDSPRA
LESDTALALNRYLCNSVLPLLTNHSHFFSDAEHHSALLDATLHTVYRMNRLKSLTKNQRD
AVSDFLVAITRELPPAMMIKLLKKVINDILTMNDMNVLVPLRLITLHYERCGKYYGSGNH
YGVASEQEKRLSMLLFDAIFDTLGSRPYDPELFGKALPCMTAIGSAISPDYTLTSGLEDV
RNKKREEEEGAWIPRTVDVSRCEIARDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSR
ANATHPRLKPFSLLKDFEKSFYKERCSECLRALMAWNYKFEMIDRDANDRASAARAISGT
SISNFSPKPIDLSSMTLEKDMVNAAEKMAEHSHLIWAKKIMNDLNSKGGFMPIPLVPWDL
LTDFERRKDRFRASEILKFLQYHGYHVECPKDEQSQNDRMKSEGERTSVEKRFAYNLLEK
LITYLEQASLKMKSVKPSQELTRRNSFKREGQDVKFFEKVVLPLMHAYFNAHKSYFLEGS
SIVQTGTASNKEKEMVANLFCRLAALLRIKNRAFGSVAKITVKCLQGLTQALDLRTLVKV
NSDIVRTSLLTFFNNCADDLYAAVNELKDGGQYSLIRGQALKSWNSFEFANQMIVPVLTT
MFAHLARNHFGTDLLLDDIQAACYKILDSLYMVTGLSSSISHRKSIAGESEKHRPGLGQC
LAAFASCFPVAFLEPEFNKSNKFSVLAKSQDQSVQVQEMLQNLSTHIPHLEKLLTDLETV
ANNNTMYSDVPNVYDVDLPLMCSYMAHWFSVGPEGKRDKDDQRASVVQTTSVSCDHINRI
FNALLKMIRNHVGIENAPWLCRVNFFAVQIIQNVTSDPVREFVLPIAERLRRMSEKAYKE
EEHMRTHPDDADEGTVAEDNARLVRDTYAFFPILMKYTDLHRAQWLKSPTWETDGVYENV
AVIFRIWSQSQHFKREELNYVAQFEEDAAAMGGGDMKTGKAAIAERKKKRREGQDKMKEY
FDRNGRPIIKKDKHAASIVIACLKRLLPVGLNVFGGRELDIVQQSKEKFIQKETEEKIRE
FIKGLLEIPVKTDPTDKNAWQLSLYRKIGKSQMRGKDEMSQEAVIEKIFNMGQVSAILHT
ITRTKDRRRRAHHRWKTEHPQMQLSQAWKKVVSTQRKRAVVACFRMVPLYGIPRHRGINF
FLPAFSRLWLEEEDVGQDQLIADICSGVEEEEGPRIEIIMEEGVPIVASSEETKEKETNP
DPLKQLIRCFQRAATSEETAASAIHEDSLYIRFADVMAKSIHIEEEDGDDGDEGEIDQAA
KEEQSQALRGEQAVLASRGAAIMCLMYLSASGGEPNEMVAQTLQLGIHLLSGGNVEIQKM
LIEYLQLKKDVRFFTSMAGLMNKCSVLNLEMFERQIKAEGLGMGAELASGDNQNLNDADF
TCSLFRFLQLTCEGHNLEFQNYLRTQPGHTTSVNLINCTVDYLLRLQESVMDFYWHYSSK
EVIDEGGKEYFLRAIQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFAHMM
EKLYKNSTQLELLREFLNLQKDMIVLMLSMLEGNVLNGSIGKQMVDALVESQPSVEKILK
FSDMFLKLKDLTTSQAFQDFDTNQDGWISPKEFQRAMESQKMYTVEDITYLMMCTDVNND
GKVDYMEFTERFHNPARDIGFNLAVLLVNLKEHITNDPRLEKIIEKAQTLLEYFDPFLGR
IEIMGSSKRVEKIYFEIQESWLEQWGKQQIRDSKNSFLFNVLQDDGGDQGKLEAFINFCE
DTIFEMQHAAAISSGDSDTKMERAIKQRDYFLQQTTASDQISETFKSGYNYGITAASALS
PQNISTTMKNVTTSVRQMTWTQLLYSIVILIIRAGLAIGWGAYLLLMTIFRFAYFLTTSS
EEEESAKHDNAKEQTKMNHDHATFSPPIVQDFHHSHVGVDAFGVGMNADHLNVNSLPDFV
PPPRPETPETVLPEEEKLLNQDIPSPTSPAAASKAPSIYESIGAPQMVQLQSEADFQQGQ
YEPKIAESNSTKTRGSILNMLARNFKTIEKITLYLAFFINVILLFHRVDISHTENQEAAS
EGDDDEEAVESIFITGMQFPYVEYEITGWMLAQILYWISVLHLSTSFALLVSFYQLKIPL
ITFKREKEIARKLMFDGCWITEEDSEELGIVDTFMWYLDRIVISAKSFPMMYWDKFVRRK
TRSKFKDQVDEETLTSILGEEKMSTDSSYDYRYSCWLWLGVILTNGQFLYRVGYLLCSAC
GVFVSPFFYAFHLVDVVLSFPMLKAILQSVTHNLQQLILTIMMTLVVVYLYTVIAFNFFR
KFYVQEGEDGEEPDRKCHNMLTCFIYHFYAGVRSGGGIGDELESPYGDDLEYPRMFYDIS
FFFFVIIILLAIMQGLIIDAFGELRDQQESATEKLESSCFICDIGKETFDRMPRGFEIHT
TKEHNFANYLFFLQHLVNKDETEYTGQETYVREKYDNRDWDFFPVGECFVKQYEDQLLQS
Download sequence
Identical sequences E3LPH3
CRE27285 XP_003114209.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]