SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE29760 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE29760
Domain Number 1 Region: 407-591
Classification Level Classification E-value
Superfamily Fibronectin type III 1.09e-26
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 2 Region: 11-44,116-186
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.15e-20
Family Voltage-gated potassium channels 0.0051
Further Details:      
 
Domain Number 3 Region: 229-344
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000785
Family Voltage-gated potassium channels 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE29760   Protein: RP24322   Gene: WBGene00059998
Sequence length 637
Comment RP24322 WBGene00059998 locus:Cre-twk-30 status:Predicted
Sequence
MSCFQVESDKMARFLSLHVLLIGSVVLYIILGAIVFQMLEGEHLDTLKKEHMDRIDQNAK
DYVDRLWDLTKKEKDTFDNVDDLIKSVKAKTSDDFFDYVDTVFYAHRAVRHGYDEDSPTW
DFANSVFFTTTMLTSIGYGYVAPSTFGGRLFGVIYCLIDKPNSGIPLTLVTVANVAKFLS
ETIFFLHYELWNKCLEWKRKRKGEVEADPAQPMFGDDENEEEILDRVRLVRFPPLTVFMF
VFVYGCIAAWVVRYWETWTYVESLYFIFISILTVGFGDIRPSPGNIWVTLAFVVGKSTLK
NYSEEIIPVGVILTTMCMDVVGRMYLKEIHYLGRKLKSNNPFYLLREAKARRRRAAMASL
LAQLAKGMIFAHKDYNELARKKSKRKKEKRRGSHVLPNEKFMFARLPPDPPSDCQVVSTS
AYSVRLAWAPPFSPDPDLTYNIRYRLKHNEDAKVRELRGIKGNTVEIMSVDSCSLYEFRI
TAHNKFGESKAVYLVQYTEPQLSPQHILATRLNANTIELTWEPPYKKSHEVKNYVVYFTE
NPNASLSEWEKIPVNGRRVVFPDLRFDWFYMFSATAVFKDGQRSPLSRALFIKTDKIEFH
KHCVGHSKTIDVMDSICEKEENETTALLKRDYVSFAV
Download sequence
Identical sequences E3LVM4
CRE29760 31234.CRE29760 XP_003111906.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]