SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE30901 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE30901
Domain Number 1 Region: 984-1289
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-69
Family Protein kinases, catalytic subunit 0.00000336
Further Details:      
 
Domain Number 2 Region: 137-272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000475
Family MAM domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE30901   Protein: RP36977   Gene: WBGene00052195
Sequence length 1435
Comment RP36977 WBGene00052195 locus:Cre-scd-2 status:Predicted
Sequence
MRKKGLWGLCLVLFQFALVNAFLPNETFDETQYYAHRFDIREAGNGTETTYLIAAESRDD
AVEKFSMLSSNCSLLSEVEEYSCKLDDKFCKYHNYPNYKTYKFQQNACECNVDSCDSETN
STKMILYPGCFCEHREEQCDFRTDNCPQWTEQSDHKELKFKIYPAKTLSYFQKFIQAGSA
TALLNRNKISMISSFPFRQSGFNCSLNFMHHFTYQSSSSRLVVRVLLKNGQNRTLYEYTH
KPIKPLWVHTTVGIGSFSEPFRVSIDCETGSTKKKKTKQKDKVFACGLANIHFEDCMDIR
DPIEKCSRGDQFLCSTPVNTKCLTDAQCDLKSDCVDGSDEMECGSVTGTMCNFDSSDGFC
DGWLQTTRIIGPQQINDPNSATPLNKFDETLSYLLRKRMPSPSTLREARRGSGQMLVYDY
DSVDMLSRRISVLQSPVFPRTNPLAYDKNSHLFETCTLRFFVCSRTYHKTWEIAIISKAG
NPFDSGTTTLYEGTYDPTHPEDSGCRWERVLIRVPRQNAGFRLGIFVNNFPRNDFFAIDD
LSFSPTCFEKSINQSTWEIPDLTVSTCGTSGSDKPLSCGRDRELDGQTGHFLKEDGSQEW
TVPVEGFYRIDACGAGGGSTNIGNGDPGDCVTLQVVHLMENIALRMIVGQVGESACLTEQ
EEEFRPASCSKTTHKERRNNDGGAGGGGATLIKFESNQWNVVVGGGAGASWTNYDDDEDD
FDSVGYGTSVVSNDFDEKCNVTCKSISHIEFSEVNLERCENSKDQQTIFGGFGGGGSSCG
MLGGSGAGYRAGNPFGKGRERSGTSNVTDNFSKDVLYFQSNKVEEGYIKIRFCRKQCPKP
SICRFRKDYYDEEYCGCPDGSNFTDSADSCACPLACPESSTCQYRNFTFEPFCLCNNGKL
LEDMSIDLCEIAESRHWSWYLMSIVVFVAAFLSPFFAYNWKKSRQTLKKQEVAMRDFIPP
EPTYDDIYFGQTTRKEALDSLETIPRDAITRGRVLGRGNFGEVYYGEYNGSKVAVKMISR
TFSASQSSQADFYNEALCMGTFQNNNIVRLIGIDFDSQPFMIAIEYMEGGDLLSFVKDSR
PNQHSLNPLHLAMSDLVKLCYDVGAGCRFLESVGYVHRDIAARNILLSTRGMNRVAKIAD
FGMAKAISNGSEYYRVHGRAMLPIKWTPPESFIDGVFTTKSDVWSFGILCWEVFSLGVVP
YPNRRNEEVMLMLTEGGRLEYPYGIPTRVYQMMRECWRTSADSRPTFSSIVETIEDILKD
PASVGMSFPIHPTVRASFAHSQSTPVSVETPMTAMTDVSLNSTFTDASTVKMATAQQDMQ
DRINLHELMLTREQPYDSEMTPCIINTIRKDLARVQYETTLTSVPQPEYLSPNSIDESVQ
LIPSSNTLTEQTPPTSLIDLNRLAVQNTGPALHRPDSLNFNDPYSSVPLLEIQTR
Download sequence
Identical sequences E3LTE8
31234.CRE30901 XP_003112682.1.11157 CRE30901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]