SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|94544|fgenesh1_kg.C_scaffold_2000046 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|94544|fgenesh1_kg.C_scaffold_2000046
Domain Number 1 Region: 19-87
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 4.97e-25
Family Hydrophobin II, HfbII 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|94544|fgenesh1_kg.C_scaffold_2000046
Sequence length 89
Sequence
MQFSIVALFATGALASVSVCPNGLYSNPQCCGANVLGVAALDCHTPRVDVLTGPIFQAVC
AAEGGKQPLCCVVPVAGQDLLCEEAQGTF
Download sequence
Identical sequences A7LNV8 G9P3M0 P79072
jgi|Triat1|94544|fgenesh1_kg.C_scaffold_2000046 XP_013941232.1.20613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]