SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|129811|estExt_fgenesh1_pm.C_160161 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|129811|estExt_fgenesh1_pm.C_160161
Domain Number 1 Region: 249-408
Classification Level Classification E-value
Superfamily eEF1-gamma domain 5.75e-61
Family eEF1-gamma domain 0.0000273
Further Details:      
 
Domain Number 2 Region: 78-207
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.09e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.00026
Further Details:      
 
Domain Number 3 Region: 1-75
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000463
Family Glutathione S-transferase (GST), N-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|129811|estExt_fgenesh1_pm.C_160161
Sequence length 408
Sequence
MAFGTLFTTADQPRATAIKAVAKANGLDLNISLVEAGKASAEHKKAHPLGKYPAFVGEDG
FALSECIAIAIYVTSQNEKTTLLGKTKQDYASILRWMSFFNTEVAPKLGAWTALLNGTKP
YNKKTVDDTAKEAGAAIDAAEEHLTHHTYLVGERITLADLFSAGLLYRGFQNFFDKQWRQ
QHPAVTRWYETIVNQPIYSAVAEKLPFLDTPALTNVAPKKPEAAKAAPKPAAAPKAAEPE
EEAAAPKAKHPLESLPKASLPLDEWKRQYSNSETPDALKWFWENVKFDEYSLWKVAYKYN
DELTLTFMSNNLIGGFNNRLEGSRKYLFGCASVYGANNDSVIEGAFVIRGQEYVPVFDVA
PDYESYEFIKLDPSKPEDRAYVEAQWSWDKPVTVNGKEYPHADGKVFK
Download sequence
Identical sequences G9NF49
XP_013948728.1.20613 jgi|Triat1|129811|estExt_fgenesh1_pm.C_160161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]