SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|130955|estExt_fgenesh1_pg.C_20477 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|130955|estExt_fgenesh1_pg.C_20477
Domain Number 1 Region: 210-315
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.4e-31
Family PDI-like 0.022
Further Details:      
 
Domain Number 2 Region: 43-161
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.86e-18
Family PDI-like 0.01
Further Details:      
 
Domain Number 3 Region: 322-430
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000783
Family PDI-like 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|130955|estExt_fgenesh1_pg.C_20477
Sequence length 672
Sequence
MRLTSTTLLSGLAAFGLFGSFVAAADEDSKAPKETYFDSLPVPPLVELTPKNFEEVANKT
KWLLVKHYSPFCHHCLAYAPTFQTAYEFYYTSKPEEAGEKDFTNFYDFKFASINCIAFSD
LCVQHGIKLYPTTTLYEEGKEARSETGGLNMTFLSSIIEESLEKSKPGSRPKTLDLPKAG
ENKRPAVDPKRAKEVEAGKTPKKPVATANEEGTSVALTAENFQRLVTMTQDPWFIKFYAP
WCPHCQDMAPTWEQLAKTMKGKLNIGEVNCDKETRLCKDVGARAYPTILFFKGGERSEYE
GLRGLGDFIQYAEKAVDLASGVPDVDLASFKALEQKEDVIFVYFYDHATTSEDFQAIERL
PLSLIGHAKLVKTRDPAMYDRFKITTWPRFMVSREGRPTYFPPLTPNAMRDTNQVLDWMR
SVWLPLVPELLVTNARQIMDHKIVVLGVLNRDDQESFQGALREIKSAANEWMDRQIQEFQ
LERKKLRDAKQMRIEEAEDRDDQRALRAAKAIHVDMNNSGRREIAFAWVDGVAWQRWIRT
TYGIDVKDGERVIINDQDNRKYWDNTVTGNYILVSRTSILETLDKVVYTPQALKPKLTIS
PFEKVFFDIRLSFTDHPYLSLGCVVGIAFGVFSWLRGRSRRGRGHFRLEDSISIKDFKEG
FLGGSNGNTKAD
Download sequence
Identical sequences jgi|Triat1|130955|estExt_fgenesh1_pg.C_20477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]