SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|150353|estExt_Genewise1Plus.C_30643 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|150353|estExt_Genewise1Plus.C_30643
Domain Number 1 Region: 4-218
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.03e-32
Family DsbA-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|150353|estExt_Genewise1Plus.C_30643
Sequence length 227
Sequence
MANYDIQIISDTVCPFCYLARARLSRAIALFKKTVPNASSSTFTIRWHAFQLDKSIPHGQ
STSVQDIAVSRFGADRLAAKRARMAQMGDQEGFGFTFSGRIGNTRDSHRLSHLGRELGGH
ELEDRVQMAMMKMFFEEGGDITSHEDLVAAAEKAGIERDVARKWLEDGSGGEQVDREVEE
MEKLGMKGVPKIMVDGKFVIEGADDVTAMFEQLYRAKEEKEKSESLV
Download sequence
Identical sequences G9NZI6
jgi|Triat1|150353|estExt_Genewise1Plus.C_30643 XP_013942155.1.20613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]