SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|152440|estExt_Genewise1Plus.C_50818 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|152440|estExt_Genewise1Plus.C_50818
Domain Number 1 Region: 115-280
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.87e-52
Family Glutathione peroxidase-like 0.0000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|152440|estExt_Genewise1Plus.C_50818
Sequence length 284
Sequence
MSHSMFASSRALQGALRKLPAQQCQRCISSSAFQPKQLRPVLPRVPVQSRQPITQKRTKY
KTIEQAKSRYSTGPFSWKAAILFVATCGGLVWYFEFEKERMQRKRVAETTKGVGRPKVGG
PFELIDQNGEKFTDEMMRGKHSLVYFGFTRCPDICPEELDKMARMLEIVDAKIPNNGLLP
IFVTCDPARDDPAALKDYLAEFSPNLIGLTGTYDEIKEMCKKYRVYFSTPRDVKPGQDYL
VDHSIYFYLMDPDGDFVEALGRQHSPEEGAKLLTDHLNDWKRSH
Download sequence
Identical sequences G9NUW0
jgi|Triat1|152440|estExt_Genewise1Plus.C_50818 XP_013944068.1.20613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]