SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|33478|e_gw1.2.1554.1 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|33478|e_gw1.2.1554.1
Domain Number 1 Region: 48-259
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.58e-43
Family Atu2684-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|33478|e_gw1.2.1554.1
Sequence length 261
Sequence
MASLIRKLFRRKEPAPLVCSVALDDEGNPVGDHADHVHTDACFVNFEPLAIAELFQSQSC
QSCPPALPGIHAGTADPNVLLLTYPVTIFDHTGWKDTFSSLSNDSRQRAYAKRWARNNLF
TPQVVVNGIVDGSGRQKEEIQALIQQAREASKARDFHVYLDANDTEVRIDTDKQEAPPHE
VSYIVYTQKEQVVKPTKGINKGKKIPHRNVVESVTKIGDWIGGNATWSLPAPRSALGPDQ
GAAVILTEGGLGGPIIAAAKV
Download sequence
Identical sequences G9P2Q2
jgi|Triat1|33478|e_gw1.2.1554.1 XP_013941021.1.20613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]