SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|83975|fgenesh1_pg.C_scaffold_1000007 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|83975|fgenesh1_pg.C_scaffold_1000007
Domain Number 1 Region: 58-171
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000299
Family Glutathione peroxidase-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|83975|fgenesh1_pg.C_scaffold_1000007
Sequence length 178
Sequence
MPITRAAANRNASTASKAKPSLAEVSKPSRERKAKVTKKTGPVKVNKGKSDKSSTLHLSI
GSKIPSTDDFGGELYLRDGTKTSLKQLVDKSRNGVIVYVYPKPWDDDAYEIYGEFEHAQL
DWEAAEMDTIGISPDSVSSTAAFVKEKDTWLPLLSNPRWILAEPSYCKLYGSMHSDIK
Download sequence
Identical sequences jgi|Triat1|83975|fgenesh1_pg.C_scaffold_1000007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]