SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|87959|fgenesh1_pg.C_scaffold_4000341 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|87959|fgenesh1_pg.C_scaffold_4000341
Domain Number 1 Region: 5-223
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.5e-27
Family Thioltransferase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|87959|fgenesh1_pg.C_scaffold_4000341
Sequence length 225
Sequence
MYQAQITFTPDTVCPWTYIAKKKLDRALTQFRSSPASSSITYTLHFEPYQLSPSFPSGSV
NRKEWYFEHKHKGIVEAEAAFQSQLRRRAESVGIDFRFDGAMGNTFDAHRVIQYFQQAKG
SEAANKLVDALYARYFEQGLHPSEDEMLIASCVEAGISEEEAKKVVLDKELGLNEVQAKL
SEIRRDVDAVPVVAIEGKKRDITLTGSKEIEEYLKALERIAKEST
Download sequence
Identical sequences G9NVX4
jgi|Triat1|87959|fgenesh1_pg.C_scaffold_4000341 XP_013943343.1.20613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]