SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_00006T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_00006T0
Domain Number 1 Region: 862-991
Classification Level Classification E-value
Superfamily CalX-like 7.72e-21
Family CalX-beta domain 0.0042
Further Details:      
 
Domain Number 2 Region: 1099-1249
Classification Level Classification E-value
Superfamily CalX-like 8.11e-21
Family CalX-beta domain 0.0035
Further Details:      
 
Domain Number 3 Region: 719-841
Classification Level Classification E-value
Superfamily CalX-like 1.44e-16
Family CalX-beta domain 0.01
Further Details:      
 
Domain Number 4 Region: 359-485
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.28e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 5 Region: 488-622
Classification Level Classification E-value
Superfamily CalX-like 9.94e-16
Family CalX-beta domain 0.0061
Further Details:      
 
Domain Number 6 Region: 1274-1346
Classification Level Classification E-value
Superfamily CalX-like 0.000000034
Family CalX-beta domain 0.009
Further Details:      
 
Domain Number 7 Region: 311-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000119
Family EGF-type module 0.008
Further Details:      
 
Domain Number 8 Region: 1000-1096
Classification Level Classification E-value
Superfamily CalX-like 0.0000262
Family CalX-beta domain 0.02
Further Details:      
 
Domain Number 9 Region: 619-750
Classification Level Classification E-value
Superfamily CalX-like 0.0000314
Family CalX-beta domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAOG_00006T0
Sequence length 1574
Comment | CAOG_00006 | Capsaspora owczarzaki ATCC 30864 conserved hypothetical protein (1575 aa)
Sequence
MAKLLLAAAILVLIASSAHAVQYRATCFARALYFTQNSGCGDGTCDPYCTGWVKFAPNGN
ANWNAGEQESHNPRWNIDINYGAVSNWAGTVQWYVDCDDNDPWPNPDDDMGWRTFDPITL
NGNEEQGSLAASPWQGVNLGGTTGGEFNIPAVYVYHRAMCDQYWYGARCGEYCRVSDPPA
CTACNPSSGVCTCAVGYQDKDCGTCQSNYWPVGTSGQAGFQCVYCVDTNTASACYTCQTG
GVKSCCTGWKSTNCDVKKNCNSFVAPPANSVAVASTCLCTTYGCTCQYSCKSGFSGGSAT
TTCQNDETWRWSSTLTCNDIDECAPGGGNQCAQTCSNTIGDYSCSCLAGYSISNAGRGPN
GCTDINECSTNNGGCGQNCNNTPGSYYCTCQPGWRLQPDGKTCLEIDECQEGLDNCDGNA
TCTNNIGSFECACFSGFSGDGTVCTDIDECAATPCAQFADCANFPGTFTCTCQIGYLGDG
FTCIANNTASFDVDSRFILFEEGSNSTNTTLHLRVSANSNRDGSLVYFDVIPTDALAGID
YIVETASPLVFNNGDTAHNISITIVGDNLPENVESIFVRLRDPLHLGIGPFNTSTIVIDA
NDNPNGLVRYVPASRAFSVNITAGSYPLVVERYSYSNLSQAVNVTISRTVPDVKNFTLII
PANKLNATINIPLPLSTVPSLAALYTYTITQAKMVGTGFAPVPGYYATSLVTINPHDDPH
GVYGFDFLTQSVQEGTAILINLRRQRGTFGSGAVRVRAITLNSNQTSGVAIASSTDYAAL
DQVLAFGEGESVIQISITAVADGIPELAEMFGVQLEFVSGLGRVDPTKALVLVTIPENDD
ARGVLSVSRIYTCSEESLIVNSVAQPNNTVFVEVVRSAGLFGSISFTWSTHDGKFNNASL
LPENWASAAQRDYVAVTGQTVTIPAGISSVQIAVTLLNDNVPEMDEFLYVQLVSASGGAR
VHPITNFTDLCINRNDYPHGLLGFNSPSVMTLGQNGERRYLVKEGEFVTATVNRYYGSFR
RVSGVVSILHNTTTSNDFVSGSPSKPVTFEAGQTVASVSWQLVGNGISSGQEATAVRTDS
PMDGQVLCVIDANDDIGALGYLNPDVFVHESEGVATLTVSRVANNPNNVDYATDAVEFTA
TGHDFDGSNENNTHTLSSLAQTQDFSIRLGDDTLPEASEAFFVYLRNVTGARLSWASVAT
VTILASDDGHGVIEFAPSRQVNPLVFAVSESAGFLRLTLWREISQIGRVNATFVLSTNVT
SHAAFAPLISVFVPSTPVNLTTDVDATPYEIVFEDGQNSTELVIPIVNNHVLQGSKYMYL
RLADVGGGARFGVSQAILILINDDEREPDSSDATTLAVASGVPAFVLLLLLLLLILLVLR
RRRRQKQAKLTPPDRHHAAVSGIELNPLHALHGTGSGYDHLHGPGTTYDSLRPAGDEGIY
DDLGAVAVAADYDRLGAPAADDTYDNIRANPVYINDKSDESGYEVTRTAAAASDSDGIYD
GLGGGAGEESPYSVAAKYQEAFGPGPDAPPQYEDTNGFAQTVQYGDANTSNGDYEDTMPG
SSTQYSSIVSGPQQ
Download sequence
Identical sequences CAOG_00006T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]