SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_00336T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_00336T0
Domain Number 1 Region: 1116-1269
Classification Level Classification E-value
Superfamily CalX-like 1.7e-22
Family CalX-beta domain 0.012
Further Details:      
 
Domain Number 2 Region: 866-993
Classification Level Classification E-value
Superfamily CalX-like 6.67e-22
Family CalX-beta domain 0.003
Further Details:      
 
Domain Number 3 Region: 362-489
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.75e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 4 Region: 723-845
Classification Level Classification E-value
Superfamily CalX-like 1.18e-16
Family CalX-beta domain 0.0081
Further Details:      
 
Domain Number 5 Region: 493-626
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000119
Family CalX-beta domain 0.0061
Further Details:      
 
Domain Number 6 Region: 1231-1365
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000235
Family CalX-beta domain 0.013
Further Details:      
 
Domain Number 7 Region: 316-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000128
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 1003-1085
Classification Level Classification E-value
Superfamily CalX-like 0.0000017
Family CalX-beta domain 0.0091
Further Details:      
 
Domain Number 9 Region: 626-754
Classification Level Classification E-value
Superfamily CalX-like 0.0000432
Family CalX-beta domain 0.027
Further Details:      
 
Weak hits

Sequence:  CAOG_00336T0
Domain Number - Region: 271-324
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0407
Family Complement control module/SCR domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAOG_00336T0
Sequence length 1654
Comment | CAOG_00336 | Capsaspora owczarzaki ATCC 30864 Emr1 (1655 aa)
Sequence
MNPRISVLCALVALLACCYQPASAAQYRATCTAYLKGMRVPGDCGSGDGACDTLCSSSAQ
FSGASTVSKSLGEIDDTTTPNWNTYYYNNVVVNTFGGQIVWWFDCEDYDPWNANDDMGSR
TFTVPMNTNTDYGSVSSSTWYDLGGTASGEFPVQNIYVAFRANCDANYYNPTCAEFCQVG
NPPACTVCNAVSGACTCAVGYQDKDCGTCQSNYWPVGTSGQAGFQCVYCVDTNSPSACYT
CQTGGVKSCCTGWKSTNCDVKKNCNSFATPPANSVAVGSTCVCTTYGCTCQYSCKSGFSG
GSATTTCQNDETWSWSSTLTCNDIDECAPGGGNQCAQTCTNTAGDYSCSCLAGYSISNAG
RGPTGCTDINECSTNNGDCGHNCNNTPGSYYCTCQPGWRLQPDGKTCLEIDECQEGLDNC
DGNATCTNTIGSFECACFPGFSGDGTVCTDIDECAATPCAQFADCANFPGTFTCTCQIGY
LGDGFTCIVNNTASFDVDSRFILFEEGSNSTNTTLHLLVNANSNRDGSLVYFDVIPTDAL
AGIDYIVETASPLVFNNGDTAHNISITIVGDNLPENVESIFVRLRDPLHLGIGPFNTSTV
VIDANDNPNGLVRYVPASRAFSVNITAGSYPLVVERYSYSNLSQAVNVTISRTVPDVKNF
TLIIPANKLNATINIPLPLSTVPSLAALYTYTITQAKMVGTGFAPVPGYYATSLVTINPH
DDPHGVYGFDFLTQSVQEGTAILINLRRQRGTFGSGAVRVRAITLNSNQTGGVAIASSTD
YSALNQLVTFGEGDSVMQISINAIADGIPELAEMFGVQLEFVSGLGRVDSTKGLVLVTIP
ENDDARGVLSVSRIYTCSEESPIVNSVGQPNNTVLVEVVRSAGLFGSISFTWSTHDGKFN
NATLLPENWASAAQRDYVAVTGQTVTIPAGVSSVQIRVTLLDDFVPEMDEFLYVQLVSVT
GGARIDPANNFTDICINRNDHPYGQLGFARSPLILGWTGERRLLVQESQFVTVTVLRVWG
TFRKVSGVVTLVHETTTSSDFTDDSPRTVTFLPGQAVATVSWSVKADTILQEPVKFFRLE
LTANGESAGQEAVTLLAATALDSTIPCVIDAEDLTNGVLRFIETDVSVDESDGKVTLQVQ
RLADPGSDVTFQTDAVPITASGHDFDASNENNTHVLLASHISMPFDIRVAVDGLPEPAET
FSVTLVNVTGAQLSWASIATVTILPSDDGNGVLEFAPSSDSNPLVMVVRENQGEVRLPVW
REIGTFGRVNMTFELTVNRTSSADFAPLLGAYIPRQPADLISDLNATPYELVMEEGQNTT
EIVLPIYDNTVSDGNRFVFIRLVSPGGGARLGTTRAMAIVIVDNEPDQTSTTNAAVIATA
TAVPIAVVLLLLLLILLVVARRRRSYRKQQQVQQAEFVNGVGLVELNPLHGLSSDAGGYD
ALQRANAGEAYDALHRPHSSAGVYEDVFANPVYAEAGYEALNKPQGTYDSLNNPEGAYDN
LDNVRNEYQRVTAAPAEPTYDSANGPANLAYAAIDHSSADSGSGSRATQANQYGNMSDNP
SAGQYDNARTTGDMEAIVAAKLQEAGLDEAAPPAYAPSTDANVQPASSDYDDVQPLGAQP
ASSEYDNVPVRAEQPATSEYDNVPQPATSEYDNV
Download sequence
Identical sequences A0A0D2WID3
XP_004365207.1.32957 CAOG_00336T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]