SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_00604T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_00604T0
Domain Number 1 Region: 1493-1776
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.63e-71
Family Protein kinases, catalytic subunit 0.00000386
Further Details:      
 
Domain Number 2 Region: 1104-1257
Classification Level Classification E-value
Superfamily CalX-like 5.89e-26
Family CalX-beta domain 0.0026
Further Details:      
 
Domain Number 3 Region: 713-835
Classification Level Classification E-value
Superfamily CalX-like 1.22e-19
Family CalX-beta domain 0.0074
Further Details:      
 
Domain Number 4 Region: 857-981
Classification Level Classification E-value
Superfamily CalX-like 5.49e-17
Family CalX-beta domain 0.0031
Further Details:      
 
Domain Number 5 Region: 358-482
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000832
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 6 Region: 1234-1355
Classification Level Classification E-value
Superfamily CalX-like 0.000000000301
Family CalX-beta domain 0.0084
Further Details:      
 
Domain Number 7 Region: 993-1111
Classification Level Classification E-value
Superfamily CalX-like 0.000000000798
Family CalX-beta domain 0.012
Further Details:      
 
Domain Number 8 Region: 518-616
Classification Level Classification E-value
Superfamily CalX-like 0.000000000968
Family CalX-beta domain 0.009
Further Details:      
 
Domain Number 9 Region: 310-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000201
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  CAOG_00604T0
Domain Number - Region: 618-726
Classification Level Classification E-value
Superfamily CalX-like 0.00183
Family CalX-beta domain 0.02
Further Details:      
 
Domain Number - Region: 35-125
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0159
Family PLC-like (P variant) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAOG_00604T0
Sequence length 1809
Comment | CAOG_00604 | Capsaspora owczarzaki ATCC 30864 tyrosine-protein kinase SRK3 (1810 aa)
Sequence
MFVLVCFLVGSAHAVQYRATCFARALYFTQDSGCGDGTCDPFCTGWVKFAPNGNANWNAG
VLSENSNPRWNIDINYGAVSDWAGTVQWYVKCDDDDPWPNPDDIMGWKTFNPITLNGNEE
QGSLTTIPWQGVDLGGTTGGEFNIPAVYVYHRAMCDQYWYGARCGEYCKVSDPPACTACN
PSSGVCTCSVGYTGKDCGTCVAPNYWPVGTPGQAGFQCVHCASTNLSTVCYTCGTGGVKS
CCDGWTGPNCDRSNVCGAFPMPPLNSIAVMNVTSCNCNFTGCMCTYACKSGFSGGSATTT
CLSSGPWSWSSTLTCADRDECAPGGGNQCNQICNNTIGDYTCSCNSGYSINNAGRGPSGC
TDLDECSTNNGNCGQNCNNVPGSYHCSCYDGFRLQGDGKSCSEIDECQEGLDNCDGNATC
TNTIGSFECACFAGFVGNGTVCTDVDECATLPCSEFADCANFPGNFTCTCQIGYAGNGVQ
CVFGNSAAFAESSRFVLLSDGASSATSPIQLRVEMVPDFDGTLVPFNVSSLDLILGVDYT
VETPSPLVFNLGDTFKSITIVVIGNDNPEPLRSIFVQLQDSVSAFNKSTIAVDANDNPNA
VVRFAAASRAFRVDITAGTYPLTIERYSYASLVNAINVTVWCDFPVPQNISIVIPANQAA
ATKIIQLPFSSVPTLDVVHTYTIVSAMVIGSGSAAAIGYYSTSRVTVNAHDDPYGVFGFS
LTHVSVAESSTGFVQLKRLKGTLGTTVVRVRSLTLSSSQANGVGIASPSDYAAVSQLVTF
SENDVEAHVSIAVLADGVPELDEMFGLLLEYVSGPGRVDATLALALVTIPENDNARGVLS
ITRVSSCFEESPLVGGVPQPNNTVAIEVIRSGGLYGAVSFTWSMHSGRFKNTTLSADNRA
SAPGDCTASSSQTVIIAAGVDRAQIQVVLLADSIPELDEYFWVQLDSASYGVTIDPVSNF
TDVCIGMNDNPFGSLAFERVNLTLSATGESRLLVRESDVVTVAVSRVGGTFHRVSGVVSI
AHETTSSADFADSSARTVTFEPGQRTALASWTISADSTQEPTELFKLVLTANGASAGQEA
TVLVGATSLDSTIPCAIEAQDGVNGVLSFVQPTVSVVEDTGKVTLTVQRVGGSATEISFQ
TNAVPLSASGDDFDASNQNNTYTLAVGETSVSFDIEVSKDSAPELDETFTVTLVNVTGAT
LSWMSVATVTILRNDDVNGVVEFAPSSGQNPLVTTISEDSGFIRLPLWREISQVGSVTVS
FVVTTDLTSDPACASLSGLGLSSAPANLTQHVDAAPFVVTFGDGQNEAELAIPLHDNSLL
DGSRVMFICLKNLQGGARFGASQAMAIVIQDDEHDTNESSSAPVAAAAAGAAAGGIVVLV
AVIVVLVSRIRRKRTRVVQNGELIASFKPQNAPTGNHQSMTRNPIFTPSDPETDSPYEVF
ISTRRAASPSEKHAEGQDSPSPTAPPAFDAMRAAFSSTRGQQEEDVYDSVYTSTIDCFQR
EQAFSRDELQLKSLLGSGNFGEVWLAHVPSRWLAKQTRQSRSSNATTVAVAVKTLKADAS
DKSKSDFAGEAQVMRRFNHPNIVSVVEVFVEQEPWMLVLELLPYGDLHKCIESCNAGGLT
PTVGEYLHIFSQVASGLSYLAGLRFVHRDIAARNCLVGAGLVVKISDFGLSRELEEQNYY
HMQTRRALPVRWMAPEFLLYRKSSPASDVWAFGVLMWEVLSACILPYEGVDAKGLVLFLE
SGQRLSRPPLCSDELWELVSSCWTWEVTDRVDVAQLHVAFARMSLDESDSVRDLGAILAR
TSSVQPTSS
Download sequence
Identical sequences CAOG_00604T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]