SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_00667T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_00667T0
Domain Number 1 Region: 1138-1260
Classification Level Classification E-value
Superfamily CalX-like 3.4e-20
Family CalX-beta domain 0.0043
Further Details:      
 
Domain Number 2 Region: 882-1038
Classification Level Classification E-value
Superfamily CalX-like 3.79e-20
Family CalX-beta domain 0.0037
Further Details:      
 
Domain Number 3 Region: 738-876
Classification Level Classification E-value
Superfamily CalX-like 5.49e-20
Family CalX-beta domain 0.0045
Further Details:      
 
Domain Number 4 Region: 373-502
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000706
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 514-627
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000889
Family CalX-beta domain 0.0038
Further Details:      
 
Domain Number 6 Region: 1268-1389
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000131
Family CalX-beta domain 0.007
Further Details:      
 
Domain Number 7 Region: 629-770
Classification Level Classification E-value
Superfamily CalX-like 0.00000000034
Family CalX-beta domain 0.023
Further Details:      
 
Domain Number 8 Region: 275-332
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000344
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 9 Region: 334-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000052
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  CAOG_00667T0
Domain Number - Region: 1024-1106
Classification Level Classification E-value
Superfamily CalX-like 0.00126
Family CalX-beta domain 0.012
Further Details:      
 
Domain Number - Region: 56-142
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0176
Family Synaptotagmin-like (S variant) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAOG_00667T0
Sequence length 1566
Comment | CAOG_00667 | Capsaspora owczarzaki ATCC 30864 conserved hypothetical protein (1567 aa)
Sequence
MARVLIALVIATAILALAPPRAQAASVAGRISWTVRHLYFTISTFSCDEGESSGVTALDP
YCNFQVRWGASGTTNTYNAVVSDIIINTNAPRWNYQRTGTATGWDGSVYFSVSCWESDAA
GQLNGNYMGVVTKNIPSMQTNYAYGTITSATSWTGMSIGALGGGCATVPNVYVYYRADCD
AGYYGPTCNEFCQVGSPAACTACNSVTGACTCSAGYLGKDCNTCDAANQYYSNGAGICTQ
CIPENSATAGYNCLTDGTRSCLPGWKGSNCNIRKSCLPNPPAPANAVANSCTTTYGSTCT
YSCQSGYAATSGSTSSTTCTDQELWSSFSLTCNNIDECAPGGGNLCAQICSDTIGNYTCS
CRSGYHQNGNGRGVGGCTSINECAANNGGCSQNCIDTPESFYCGCFSGYRLAGDGTSCPD
IDECAENLDNCHANATCTNAPGSFLCNCISGYSGNGVTCTDIDECAAPAAPCDPNAGCLN
LPGTFKCTCDVGFVGNGFSCVANNSASFMADLRLVVTSEGTTVLLYVNTTVARDGSLVYF
TVTGVEAVLGEDYVVVTPSPLEFNLGDTVKAIEITIIADGVAEDVEKLTVQLYDARYLSI
GEHNQSTVVIDANDHTNGAVRMVPESRDLRVSITAGSYPLTVERYAAASLDQAVNVTIHR
GSGVARRDALADQDFTLIIPANSNQATLNVPLPLSTTPSLDVTYTYSLAEAAMVGGGPAP
ALGYYASASVTVDAHDDPYGVFGLAFATARLNESSTTQILVTRSQGMFGTTVVRVRTTVL
TVNQAGGVQLASASDFTPFSTLLTFTPSDSSLTVPITIVADGIPEVDEIFGVVLELVSGN
GRIDPSAALEKITIPENDDARGVLSVTRISSCSEESLVVGGVLQPNNTVQVEIRRSAGLY
GDISFSWSTHDGKFDDATLLSQNTALAAQPDYNAVTRQVVTMGAGVDRIQISVQLLDDAV
PELDEYFYVQLDGAMGGARIDPINNFTDVCISNNDVPYGQLAFEHPSDMRLGPAGVRRWL
FQQGDTMAVVVKRYYGAFHAISGLVTIVMGSDASPAEASDFVGGVVTQPVSFAEGETSKV
LYWTAANDSIADADYKTFRFVLSANGASSGEEATSLLTTSSLDSQIPAVIDAKAPGQGVL
GFVATDISVQEVTELVTLFVTRNGASQSAVTYTTYARAGTASVDDFDASNTNNAHTLAQS
DSTQGFSLAILDDDIPEGSETFTVELQNVVGARRAWACVATVTIVASDDGNGVIAFANST
TTDTPVIASVSENSGTLRLPLLREIGLFGQVTVTFVISTDVRSHADLDPLRQLSLPPARS
NLTRDIDEMPYEVVFADGQDEGFLDIPIYDTAGYQGTRVFFIRLTLVAGGARLGAQRAMA
VLITDNERAPPPSDNGSTSAATVGIAVGVPAVLLLIILLIVLLLVAARRKHKKEKRAREP
PMSLTGSVVGIELNPLRRSDNGTYDTLHPQDSTYDTLGGAGYDSRVDNPIYDVSVDDNNQ
LYDTLNGAGNRPPPPPATVPGSTYAQLDHQSPTNSAPPSIGSPAADYEEFASAAHQRKME
EAVGQM
Download sequence
Identical sequences A0A0D2X0I8
CAOG_00667T0 XP_004365538.1.32957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]