SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_00758T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_00758T0
Domain Number 1 Region: 1630-1916
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-32
Family Kelch motif 0.018
Further Details:      
 
Domain Number 2 Region: 274-554
Classification Level Classification E-value
Superfamily Kelch motif 8.24e-31
Family Kelch motif 0.0082
Further Details:      
 
Domain Number 3 Region: 18-139
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-19
Family Spermadhesin, CUB domain 0.00098
Further Details:      
 
Domain Number 4 Region: 1406-1439,1531-1594
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000027
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 5 Region: 1117-1273
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000361
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 6 Region: 2421-2465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 7 Region: 1300-1348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000414
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 8 Region: 2245-2375
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000534
Family Growth factor receptor domain 0.0097
Further Details:      
 
Weak hits

Sequence:  CAOG_00758T0
Domain Number - Region: 1348-1396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 2374-2423
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000307
Family Laminin-type module 0.028
Further Details:      
 
Domain Number - Region: 760-794,826-867
Classification Level Classification E-value
Superfamily Anthrax protective antigen 0.0824
Family Anthrax protective antigen 0.043
Further Details:      
 
Domain Number - Region: 1872-1970
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0863
Family Galactose oxidase, central domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAOG_00758T0
Sequence length 2958
Comment | CAOG_00758 | Capsaspora owczarzaki ATCC 30864 predicted protein (2959 aa)
Sequence
MLALALLLLLALISPSAAADCSGQRVLIANSTSGTFTPSDSGYPAFTTCQWLIEAPALAN
GGTPLPILLEFLTFDTECAYDFVDVYDGVNSTSPKLGALNGQIAVAPLVARSGHMLVVLI
SDINYVTAGFTARYSINPCPANCSDRGICQANGHCACNPGFADQGCQTELCPNNCAAALG
QGQCDLATVHGCVCNAGYGGLDCSQPVDDLNDGWTLLVGGASSGNTGTERGFHTTVYSPL
NHTIFVYGGYSQEDQLLGNVVAYNLVTRARPRELTFTAHVPSPRYSHSAILTPDNLMVVY
GGITLDQHISDEVWVLSLNRSVWEQRIPAVGGISPPPLTGHSATYIPSSNSMVVIGGKTT
FDPFPTSIYEYSIAANRWYQRTPRGFIAAGVYGHSSVYVEHLHSIFVYGGIRPLSSSYSY
RLNTLYVLQVDHMRWIQLLPSNPIRASAFHGAWLGRSERSMYIQGGYVMSHNENDNRCFT
NDLFAFDFDSNRFRTVEDNSDAPTRYLPGRRMGQGVVTVRDSVSPALAAVDAVLVGGFDG
QALSDAVAYHEETNPCLSAMQQALASGVSGDVGSGAVMQQCQSNPSCVACSTTLASGFVL
PNITAQDVVLSSLLNSSQVTTACIQLTDIARYNCSMALPTTLTQGHASQSFCEALRFCSD
CTVFSDCGWCATTATCVNASSVLGCPASLSGQAPAPIVVGLAACVSSSVTNGSVAQERWY
NVGGSSVQDMSVLSTYPDYPDIVTVRSVELAADMNGDAFTQGTRVRGFLVPPETGNFTFF
IASSMSSVLGLSTAADSNDMSLVVNIASVNYFSPFRDYTAQPSQQSAPVFLAANRRYLFT
IINKQSGEWGNHFSVAWLLPSQNAFGNATSAEASVVSAQFLVPYYSSTSNSTATRANMTL
ALAGAVSCSTHPSCKGCIADASCAWCKSTGRCAERMTGLQMTASNTTSVCPQDALEVDDQ
SCPLCGNYFTCRGCVSSSTSCQWAYGSCYPSQYGIDSSATVTAPAFCPTPCRNFTSCATC
VGNGNPAACNWCPATQTCDEISSFVAVFTAGQCGTGYATDTSMCVDCSRFGDCRSCLAQD
TCGWCSNTTNGLGGVCMGGTLSGATAECAANPSRQWSWFTCPDINECALGLSNCASNATC
QNTPDSFTCTCNPGFLGDGVSCAPDCSAVPSSNSSDPTLRPSCGDMGVCVAPNTCECDPV
WTGTDCRTSCSCNGVLNCTAALNCVDIDECAQGLDDCDVHADCVNVPSTFECVCKAGYAG
NGTFCEPVCPGGCNGGVCSSPSNCTNCPFGYTGASCQVACQCNGHSDCLPDAPNVCLSCQ
NRTTGPSCNQCIPGSYGTPTQPAGCQACACNGHANTVIGECNNVTGVCFCLPPYEGPSCT
ACASGFYYSATNKLCLAACSGRKTLRFDQGAIGTNGVYPPDSVCSWLIVAEPSAVSNASY
FVASRPERARFDDGDDDDDDGMDTATASTTLRSTNINKQQSQSVKAFVERAPFLDSDHGR
EIARRILGSDSEAAEIVSEQSLTPLAITLDFYSFGSECLFDYLFVFDGSSTSAPLLGSFS
GLAVIPPIIVARSGTMLVVMYSDINYTVGGFEANVNVSSASPALTWSTLSQDQAVIVGPA
TNAAQASIILPTDFPPRAGHTAQYDASRNSVFVFGGYGQRDTVLNDLWQFDVRSRRWTLV
QPADASAAVPRGRHSHAMVLSPERDSLIVVGGWAYEPFQPVGDIWEFHLGTRTWNLLHAG
SLATDLPVATLLPAISGHSATLVDSTIYILGGRTAQTNFNTRVFAFSFALGAVRVVNTVG
VNALGMYGHTAVYSPGTDEIIVFGGIQLLDNNLIYTSNSARLYSFVVGKKAWRSLPDRVS
PDGLNVLPSANHAAVFVPTGSYMIVVGGSSFIHGWLEMCMTATVSMFAPSCRVWALPNVP
LSSPVTVANSMSNRLGHALVFVPANFDGDADIAARVLLIGGFDGRVRADVHSLSVPASLC
SLYSMGRCLSDASCTWCATPLSANYSGPLCLPSSSNTASICNQTTSNNGDCSIDCSSASI
SCEACSSLRSGCSWCTGTRQCQAANATCTSGQSIPYNGICPLYPCAAKQSCRECTVSGQC
SWTGSACTTASPPNAITNIANCRAPCSSNTNCSTCLLADNTGNIPCLWCESTSTCLDFNA
YTGVFDFGQCFEWSQVPDRCAPDCSVFQTCDQCQSNLRCGWCADPGALGTGRCLNGNSEG
PDPGLNCTVPSPAYIGNSTAPPTWNYATCPDVDECLTGQANCPVNSTVCVNTPDSYECQC
LPGYQPSGSTCIAYCAQQCVFGVCVQPNVCKCNRGYIGLNCSMDCGCNGHSTCQTYGVCE
RCMDNTAGLRCEVCSDGYYGNPVNGQSCSSCYSHCNQHTTSCNPATGICSGCNNSTTGDL
CQICLPGFTRLGQNPVICGPCICNGHSSTCDAITGVCNCQDNTRGTQCEQCARGYMGLPT
NGNQCFLVLGEGELQGPDQVGRGEALYYAISPKYTNVDIRLTVDVFDGLVTTYLSPRSDK
AVKADTEVQTGLSRRTDLVISYLDHDFLSSHFYLQVHGTSNATFMVYFAQRVTQIDLFVF
FSVFFSCFFLLLSVMFLVWRARMSRARRLAIARRQTELRQMASRPMSSVRVIMSQAMGNY
RKLALAPIAYQPLVNGQATTMTVLVELPGPGSNAQAGTTSSPVPVAGKPANPVARNVAAV
AALAPMAASWERKPPLVIASNKSIEFELLETSFGGDEAEPGEPGDVALTELAGAEGRASS
SSSSSSSSSPLSSTGHDEDAVASGNADAASSVDQKEPVAPAQQSSAEPDAVENDQASPRP
SAEEGTAAVAGEPGQPSPSDAPGAPEQANLSDAIPAGEGVQAATDAAVEPVVNTAAKEAP
SRSAAPATATAATVARPQSSLPGLRTVAFATSIIALDRRTYEVLTVPLTQDDTALKEPRR
PGHFLTSLLRQRRRNQQP
Download sequence
Identical sequences XP_004365629.1.32957 CAOG_00758T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]