SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_00999T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CAOG_00999T0
Domain Number - Region: 632-669
Classification Level Classification E-value
Superfamily EGF/Laminin 0.013
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAOG_00999T0
Sequence length 899
Comment | CAOG_00999 | Capsaspora owczarzaki ATCC 30864 hypothetical protein (900 aa)
Sequence
MGGIRSWVPLSSISSSSSSSSNGGNNNNQECETDARWPVVAQASSLFLPRYDRCTHQSMQ
KQKQQSPSQRHRWARAAAVMFVAALFAVATSPLLVAITRPPPTGTSATTTPMTGDHRTEV
VTAYSSDRTQRPEQQQQQHHHQHQRREAKLTTKLGSALEQQQQLPGARSRVMHDKLTSDA
NIQEMQQQQEDVDSQVALASAGSADPHYQLTEPLSLSISSQPIDFYDDYESLAVMSFAVP
AGLASAIIFIDLSDSSNPTFCQSTVQLWMRRGALPIPAPAYGGLYDKEWIIQPRGVLTIQ
LDSPAPGEYFFAATLPTGDLQTGSDSNSHSCSYGATVSFTRLSLASITTVTPSGSASATF
STTAAAVTTATSVFRFLPSDAAWGASMNISVSSTVTGPVCTSPANLTVSLFSPTQPGLPD
AVSGANLYDSRTCQLARLGPNGALLGVQCNVADLALTDFTYAYSYVRVTIQGACTGESFT
ADLQIGSLACSSSLLTGPGCLSQVVPLSPFDFPWATYGTFFLPSRTVVVVPDVMTLLPLN
NQLALPTLNFQVAGSLLYQNAALAAPYKVYLRTGVPPTSTAYDSVFELTSVGGTFDMPFV
VAGMTYIGVFLNSSDSPPLSSTVTYQIQVSPVDCLQSCSHGTCTLDTFGASLVSYCSCNR
PYSGWSCDEIDDYSAYIGYMFFLTVSNLAFLPAIIVSIRRKLWTECVVYTFTMFGSAFYH
ICDSNISLCMYPYDAMGVADFYGSYVSFWFTFIYLARLVSPWKHVLQIMGMLGLLIGVTV
DRFSAINLAVLAAVGVALIVFTWVRMCRAAHVRWIKYFIWWRLAVGLAIAIVGLCIFGFV
QTDSNYGWTHSLWHICIMSSVFFLLISLYEPPDLAVQVDEMRRRSVHTQVKPEEEQSQL
Download sequence
Identical sequences CAOG_00999T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]